DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est4 and cest-12

DIOPT Version :9

Sequence 1:NP_524266.1 Gene:alpha-Est4 / 40906 FlyBaseID:FBgn0015572 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_499576.4 Gene:cest-12 / 176642 WormBaseID:WBGene00013540 Length:850 Species:Caenorhabditis elegans


Alignment Length:417 Identity:107/417 - (25%)
Similarity:169/417 - (40%) Gaps:99/417 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VQTTHGKVRGILL------KSLYDEQFYAFDGIPYAVPPLGTLRFKEPHDLKPWH-GIRDCSKPL 69
            |..:.|.|:|..:      ..||..|..||.||||...|:|.||.:.|..|..:: .:.|.:...
 Worm    37 VSCSQGSVQGRQVNLGNDQSQLYSGQANAFTGIPYCQAPVGNLRLQPPQPLNQFNTTLHDATYFR 101

  Fly    70 SKCLQVSTLTKEVEG---SEDCLYLNI---SVKTLNGDPMPVMVYIHG--GAFKGG-DSSRRAWG 125
            .||.|::.      |   :|||||||:   .....|.: :.|:|.|.|  |...|| |.::....
 Worm   102 PKCPQLNA------GGPTNEDCLYLNVYTPQAGNTNAN-LSVLVLIDGSNGFSNGGCDQNQEKGI 159

  Fly   126 PDYFMKENVVYISIGHRLGPLGFLSLNDPDLEVPGNAGLKDVILALRWIRANAANFNGDPERITI 190
            ....::..:|.:::.:|:|.|||.:....  .|..|.|:.|.:.|:|||:....||.|:|.:||:
 Worm   160 ISNLVQRQIVVVTMQYRIGALGFFTTYTN--SVQSNLGMLDQVQAMRWIKTEIVNFGGNPNQITV 222

  Fly   191 FGHSSGSMTVQLLLASPQSEGLFHRAILLAGF---------SMELNRLPQMEYRLAK-------- 238
            .|...|:..|.....||.|:.||::||:.:|.         ::..|  ||::....:        
 Worm   223 AGQDDGACAVSAHCLSPMSQNLFNQAIVQSGSVYSCYNPTPAVPTN--PQVQVTTPRPMYDQSNT 285

  Fly   239 ---------HLGYEGDNVDSQVLEFLLKA---DPA--LIVSADFFTPLEKRQGHNMPFKPSIESY 289
                     :.||:...:.|........|   ||:  |..:....:|.:...|.....:..:::|
 Worm   286 GYGNAGYQNNYGYQPQPITSTSSYNSANAQYDDPSQQLAQTLCNISPDQWNNGQTQNIQNCMKNY 350

  Fly   290 ST----------PNAV--------LLAEPIDLQRTTWSNRIPIILGA-------------NSGEG 323
            :.          |||.        .|...|| ..||....||||:|.             |:|:|
 Worm   351 TVDFFVNQQPGGPNATWMIVRDTSFLPGSID-SLTTRRPNIPIIIGTVQDEDADYAFKLINTGKG 414

  Fly   324 MS-------IFSFVKMNPSWLKEFQCN 343
            ..       ||.|.:.|.  |.:.|.|
 Worm   415 SDPNNLDDWIFDFARKNK--LNQTQAN 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est4NP_524266.1 Abhydrolase 7..529 CDD:304388 107/417 (26%)
Aes <104..>219 CDD:223730 38/117 (32%)
cest-12NP_499576.4 Abhydrolase 37..>400 CDD:389770 97/374 (26%)
Abhydrolase <678..774 CDD:389770
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.