DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est4 and Cel

DIOPT Version :10

Sequence 1:NP_524266.1 Gene:alpha-Est4 / 40906 FlyBaseID:FBgn0015572 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_034015.1 Gene:Cel / 12613 MGIID:88374 Length:599 Species:Mus musculus


Alignment Length:89 Identity:16/89 - (17%)
Similarity:33/89 - (37%) Gaps:34/89 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 YAHGLGEYLG-QSSQK--------------------MNVITSTVVGEKREDCIENAQMSTKCDKW 108
            |.:...|::| ||.|:                    :.::|:.|:|..::  :....:.....:|
Mouse   177 YLNNYYEFVGVQSCQEVLSLYVLLWVLTALNLLAFVLGILTTAVLGSIKD--MRRGVIGLNMSQW 239

  Fly   109 PIVVFSHGLGGSR--TFYSTYCTS 130
                     |||.  :|...:|:|
Mouse   240 ---------GGSSLFSFDGAHCSS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est4NP_524266.1 alpha/beta hydrolases 8..529 CDD:473884 16/89 (18%)
CelNP_034015.1 COesterase 26..542 CDD:395084 16/89 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 553..599
4 X 11 AA tandem repeats, O-glycosylated region 559..588
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.