DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est4 and LOC107987423

DIOPT Version :9

Sequence 1:NP_524266.1 Gene:alpha-Est4 / 40906 FlyBaseID:FBgn0015572 Length:541 Species:Drosophila melanogaster
Sequence 2:XP_016885725.1 Gene:LOC107987423 / 107987423 -ID:- Length:286 Species:Homo sapiens


Alignment Length:311 Identity:63/311 - (20%)
Similarity:108/311 - (34%) Gaps:65/311 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 DSQVLEFLLKADPALIVSADFFTPLEKRQGHNMPFKPSIESYSTPNAVLLAEPIDLQRTTWSNRI 312
            :.::||..||..   .:|.|.       ||.....:|.:.:. ....:||..|.:||.....:.:
Human    10 EEELLETTLKMK---FLSLDL-------QGDPRESQPLLGTV-IDGMLLLKTPEELQAERNFHTV 63

  Fly   313 PIILGANSGE-----GMSIFSF----------VKMNPSWLKEFQ--CNPERVLPWTLRNRCDPGQ 360
            |.::|.|..|     .|.:.|:          ..|:..| |.:.  |..:.::|        ...
Human    64 PYMVGINKQEFGWLIPMQLMSYPLSEGQLDQKTAMSLLW-KSYPLVCIAKELIP--------EAT 119

  Fly   361 RRQLGQALIHHFCEAHGHELTVDHTNGLVELFTHGFVHAMDRLIQSRLTYGQAPTYLYRFDFDSP 425
            .:.||           |.:.||...:..::|...........::........||||:|.|.    
Human   120 EKYLG-----------GTDDTVKKKDLFLDLIADVMFGVPSVIVARNHRDAGAPTYMYEFQ---- 169

  Fly   426 DFNFYRIRFMG--KEQRGVG-HVDELGYIFKLPATFKLDKSRPEFTAIRRLVAMFVQFAATSDPN 487
                ||..|..  |.:..:| |.|||..:|..| ..|...|..|....:.::..:..||...:||
Human   170 ----YRPSFSSDMKPKTVIGDHGDELFSVFGAP-FLKEGASEEEIRLSKMVMKFWANFARNGNPN 229

  Fly   488 APLTKSLVDWKPVTRFGKRMVLNISEELKFIPQPEMPKLKFFDRLYEMAGV 538
            .   :.|..|....:  |...|.|....:...:.:..::.|:..|:....|
Human   230 G---EGLPHWPEYNQ--KEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est4NP_524266.1 Abhydrolase 7..529 CDD:304388 60/300 (20%)
Aes <104..>219 CDD:223730
LOC107987423XP_016885725.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D206516at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.