DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est5 and CXE5

DIOPT Version :9

Sequence 1:NP_001246965.1 Gene:alpha-Est5 / 40905 FlyBaseID:FBgn0261393 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_175389.1 Gene:CXE5 / 841390 AraportID:AT1G49660 Length:319 Species:Arabidopsis thaliana


Alignment Length:195 Identity:48/195 - (24%)
Similarity:83/195 - (42%) Gaps:49/195 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LYLNVYSKQLKSEKPLPVMVYIYGGAFTVGEATRELYGPDYFMTKDV-----VLVTLNYRVDCLG 149
            |:|...|.:|.:...||:::||:|||:.:......||  ..::|:.|     :.|::.||     
plant    57 LFLPHKSTKLTAGNKLPLLIYIHGGAWIIESPFSPLY--HNYLTEVVKSANCLAVSVQYR----- 114

  Fly   150 FLSLKDPSLKVPGNAGLKDQVLALKWVKQYISNFNG---------DDSNITVFGESAGGCSTHFM 205
                :.|...||  |..:|...|::|:..: ||.:|         |...:.:.|:||||..:|.|
plant   115 ----RAPEDPVP--AAYEDVWSAIQWIFAH-SNGSGPVDWINKHADFGKVFLGGDSAGGNISHHM 172

  Fly   206 MC---TEQTRGLFHKAIPMSGTVH-NYWANNPAEDFAF--------------RLAQQNGFTGEND 252
            ..   .|:...|..|.|   ..|| .:|..:|.:::..              ::|..|...|.:|
plant   173 AMKAGKEKKLDLKIKGI---AVVHPAFWGTDPVDEYDVQDKETRSGIAEIWEKIASPNSVNGTDD 234

  Fly   253  252
            plant   235  234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est5NP_001246965.1 COesterase 7..510 CDD:278561 48/195 (25%)
CXE5NP_175389.1 Aes <55..277 CDD:223730 48/195 (25%)
Abhydrolase_3 75..278 CDD:285143 42/177 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X33
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.