DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est5 and AT1G49650

DIOPT Version :9

Sequence 1:NP_001246965.1 Gene:alpha-Est5 / 40905 FlyBaseID:FBgn0261393 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_564550.1 Gene:AT1G49650 / 841389 AraportID:AT1G49650 Length:374 Species:Arabidopsis thaliana


Alignment Length:260 Identity:64/260 - (24%)
Similarity:106/260 - (40%) Gaps:88/260 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LYLNVYSKQLKSEKPLPVMVYIYGGAFTVGEATRELYGPDY--FMTKDV-----VLVTLNYRVDC 147
            |:|...|.||.:...||:::|.:|||: :.|:.   :.|.|  |:|:.|     :.|::.||   
plant   113 LFLPHKSTQLAAGNKLPLLIYFHGGAW-INESP---FSPIYHNFLTEVVKSANCLAVSVQYR--- 170

  Fly   148 LGFLSLKDPSLKVPGNAGLKDQVLALKWV---------KQYISNFNGDDSNITVFGESAGGCSTH 203
                  :.|...||  |..:|...|::|:         :.:|:.: .|...:.:.|:||||..:|
plant   171 ------RAPEDPVP--AAYEDTWSAIQWIFSHSCGSGEEDWINKY-ADFERVFLAGDSAGGNISH 226

  Fly   204 FMMCTEQTRGLFHKAIP-MSGTVHNY---WANNPAEDFAFRLAQQNGFTGENDDAKVLEYLQGVP 264
            .|    ..|....|..| :.|||..:   |..:|.:              |:|          |.
plant   227 HM----AMRAGKEKLKPRIKGTVIVHPAIWGKDPVD--------------EHD----------VQ 263

  Fly   265 ARDLVNHNLLTPEHRRNGLLFAFGPTVEAYVGEDCVVPKPPVEMARDAWSNNFPVMLGGTSFEGL 329
            .|::           |:|:         |.|.|..|.|. .|:.|.|.|   |.|:..|::|.|:
plant   264 DREI-----------RDGV---------AEVWEKIVSPN-SVDGADDPW---FNVVGSGSNFSGM 304

  Fly   330  329
            plant   305  304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est5NP_001246965.1 COesterase 7..510 CDD:278561 64/260 (25%)
AT1G49650NP_564550.1 Aes 66..372 CDD:223730 64/260 (25%)
Abhydrolase_3 131..353 CDD:285143 57/242 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X33
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.