DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est5 and AT1G19190

DIOPT Version :9

Sequence 1:NP_001246965.1 Gene:alpha-Est5 / 40905 FlyBaseID:FBgn0261393 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_173353.1 Gene:AT1G19190 / 838502 AraportID:AT1G19190 Length:318 Species:Arabidopsis thaliana


Alignment Length:305 Identity:72/305 - (23%)
Similarity:114/305 - (37%) Gaps:76/305 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PVPADPWSGVL--DCTHYAEKPTQRGLLTREIEGGEDCLYLNVYSKQLKSEKPLPVMVYIYGGAF 116
            |...:|.:||:  |..:..||    .|..|        :||...|.....||.:|::||.:||.|
plant    31 PPSLNPENGVVSKDAVYSPEK----NLSLR--------IYLPQNSVYETGEKKIPLLVYFHGGGF 83

  Fly   117 TVGEATRELYGPDY--FMTK-----DVVLVTLNYRVDCLGFLSLKDPSLKVPGNAGLKDQVLALK 174
            .:..|    :.|.|  |:|.     |.:.|::.||         :.|...:|  ...:|...|::
plant    84 IMETA----FSPIYHTFLTSAVSATDCIAVSVEYR---------RAPEHPIP--TLYEDSWDAIQ 133

  Fly   175 WVKQYIS--------NFNGDDSNITVFGESAGGCSTHFMMCTEQTRGLFHKAIPMSGTV--HNYW 229
            |:..:|:        |.:.|.|.:.:.|:|||....|.|........|..:...:||.:  |.|:
plant   134 WIFTHITRSGPEDWLNKHADFSKVFLAGDSAGANIAHHMAIRVDKEKLPPENFKISGMILFHPYF 198

  Fly   230 ANNP-AEDF----------AFRLAQQNGFTGENDDAKVLEYLQGVPARDLVNHNLLTPEHRRNGL 283
            .:.. .|:.          .:|:|..:...|..|           |..::|..: ||....|..|
plant   199 LSKALIEEMEVEAMRYYERLWRIASPDSGNGVED-----------PWINVVGSD-LTGLGCRRVL 251

  Fly   284 LFAFGPTVEAYVGEDCVVPKPPVEMARDAWSNNFPVMLGGTSFEG 328
            :...|..|.|..|...|     .|:.:..|.....||  .|..||
plant   252 VMVAGNDVLARGGWSYV-----AELEKSGWIGKVKVM--ETKEEG 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est5NP_001246965.1 COesterase 7..510 CDD:278561 72/305 (24%)
AT1G19190NP_173353.1 Abhydrolase_3 75..293 CDD:400284 57/249 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X33
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.