DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est5 and CXE17

DIOPT Version :9

Sequence 1:NP_001246965.1 Gene:alpha-Est5 / 40905 FlyBaseID:FBgn0261393 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_197112.1 Gene:CXE17 / 831465 AraportID:AT5G16080 Length:344 Species:Arabidopsis thaliana


Alignment Length:300 Identity:69/300 - (23%)
Similarity:112/300 - (37%) Gaps:88/300 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 YLNVYSKQLKSEKP---LPVMVYIYGGAFTVGEATRELYGPDYFMTKDV----VLVTLNYRVDCL 148
            :..||.....:..|   ||::||.:||.|.||.|....| .|:..:..|    |:|::|||:   
plant    75 WTRVYIPDAAAASPSVTLPLLVYFHGGGFCVGSAAWSCY-HDFLTSLAVKARCVIVSVNYRL--- 135

  Fly   149 GFLSLKDPSLKVPGNAGLKDQVLALKW-VKQYISNFNG--------DDSNITVFGESAGGCSTHF 204
                  .|..::|  |...|.|..:.| |||.||...|        :.||:.:.|:|||....:.
plant   136 ------APEHRLP--AAYDDGVNVVSWLVKQQISTGGGYPSWLSKCNLSNVFLAGDSAGANIAYQ 192

  Fly   205 MMCTEQTRGLFHKAIPMSG--TVHNYWANN-------------------PAEDFAFRLAQQNGFT 248
            :.......|.:...:.:.|  .:|.::...                   .|.|..:|||...|  
plant   193 VAVRIMASGKYANTLHLKGIILIHPFFGGESRTSSEKQQHHTKSSALTLSASDAYWRLALPRG-- 255

  Fly   249 GENDDAKVLEYLQGVPARDLVNHNLLTPEHRRNGLLFAFG---PTVEAYVGEDCVVPKPPVEMAR 310
                           .:||   |....|      |:.:.|   ||...::.|..::.:..:||.:
plant   256 ---------------ASRD---HPWCNP------LMSSAGAKLPTTMVFMAEFDILKERNLEMCK 296

  Fly   311 DAWSNNFPVMLGGTSFEGLFMYPAVSANLKALD--SLSQD 348
            ...|:       |...||: ::..|......||  |:|:|
plant   297 VMRSH-------GKRVEGI-VHGGVGHAFHILDNSSVSRD 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est5NP_001246965.1 COesterase 7..510 CDD:278561 68/299 (23%)
CXE17NP_197112.1 Aes <76..333 CDD:223730 68/298 (23%)
Abhydrolase_3 95..319 CDD:285143 59/269 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X33
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.