DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est5 and AT5G06570

DIOPT Version :9

Sequence 1:NP_001246965.1 Gene:alpha-Est5 / 40905 FlyBaseID:FBgn0261393 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001330981.1 Gene:AT5G06570 / 830545 AraportID:AT5G06570 Length:344 Species:Arabidopsis thaliana


Alignment Length:331 Identity:68/331 - (20%)
Similarity:110/331 - (33%) Gaps:132/331 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 HYAEKPTQR---GLLTREIEGGEDCLYL----------------------------------NVY 95
            |.::...:|   |.|..|.:..|||:.|                                  ::|
plant     5 HISKTKRERLRMGSLGEEPQVAEDCMGLLQLLSNGTVLRSESIDLITQQIPFKNNQTVLFKDSIY 69

  Fly    96 SK----QLKSEKP--------LPVMVYIYGGAFTVGEATRELYGPDYF-------MTKDVVLVTL 141
            .|    .|:..||        |||:|:.:||.|..|..:    .|.:.       .:.:.::|:.
plant    70 HKPNNLHLRLYKPISASNRTALPVVVFFHGGGFCFGSRS----WPHFHNFCLTLASSLNALVVSP 130

  Fly   142 NYRVDCLGFLSLKDPSLKVPGNAGLKDQVLALKWV-KQYISN------FNGDD---SNITVFGES 196
            :||:         .|..::|  |..:|....|.|: .|.:|:      .:|.|   ..:.|.|:|
plant   131 DYRL---------APEHRLP--AAFEDAEAVLTWLWDQAVSDGVNHWFEDGTDVDFDRVFVVGDS 184

  Fly   197 AGGCSTHFM----------MCTEQTRGLFHKAIPMSGTVHNYWANNPAE--------DFAFRLAQ 243
            :||...|.:          :...:.||.........|.......|.|:|        |..:||:.
plant   185 SGGNIAHQLAVRFGSGSIELTPVRVRGYVLMGPFFGGEERTNSENGPSEALLSLDLLDKFWRLSL 249

  Fly   244 QNGFTGENDDAKVLEYLQGVPARDLVNHNLLTPEHRRNGLLFAFG---PTVEAYVGEDCVVPKPP 305
            .||.|                 ||   |::..|          ||   ||:|:...|..:|....
plant   250 PNGAT-----------------RD---HHMANP----------FGPTSPTLESISLEPMLVIVGG 284

  Fly   306 VEMARD 311
            .|:.||
plant   285 SELLRD 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est5NP_001246965.1 COesterase 7..510 CDD:278561 68/331 (21%)
AT5G06570NP_001330981.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X33
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.