DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est5 and CXE13

DIOPT Version :9

Sequence 1:NP_001246965.1 Gene:alpha-Est5 / 40905 FlyBaseID:FBgn0261393 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_190439.1 Gene:CXE13 / 824031 AraportID:AT3G48700 Length:329 Species:Arabidopsis thaliana


Alignment Length:219 Identity:59/219 - (26%)
Similarity:92/219 - (42%) Gaps:56/219 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 QRGLLTREIEGGED-CLYLNVY------SKQLKSEKPLPVMVYIYGGAFTVGEATRELYGPDY-- 130
            |.|::::::....| .|.|.:|      :.:.::...||::||.:||.|.|..|    :.|.|  
plant    37 QNGVVSKDVVYSPDNNLSLRIYLPEKAATAETEASVKLPLLVYFHGGGFLVETA----FSPTYHT 97

  Fly   131 FMT-----KDVVLVTLNYRVDCLGFLSLKDPSLKVPGNAGLKDQVLALKWVKQYIS--------N 182
            |:|     .|.|.|:::||         :.|...:|  ....|...|||||..:|:        |
plant    98 FLTAAVSASDCVAVSVDYR---------RAPEHPIP--TSYDDSWTALKWVFSHIAGSGSEDWLN 151

  Fly   183 FNGDDSNITVFGESAGGCSTHFMMCTEQTRGLFHKAIPMSG-----TVHNY-WANNPAE-----D 236
            .:.|.|.:.:.|:|||...||.|........|..:::..||     .||.| |:..|.:     |
plant   152 KHADFSKVFLAGDSAGANITHHMTMKAAKDKLSPESLNESGISGIILVHPYFWSKTPVDDKETTD 216

  Fly   237 FAFR--------LAQQNGFTGEND 252
            .|.|        ||..|...|.:|
plant   217 VAIRTWIESVWTLASPNSKDGSDD 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est5NP_001246965.1 COesterase 7..510 CDD:278561 59/219 (27%)
CXE13NP_190439.1 Abhydrolase_3 77..305 CDD:400284 51/179 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X33
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.