DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est5 and AT2G45610

DIOPT Version :9

Sequence 1:NP_001246965.1 Gene:alpha-Est5 / 40905 FlyBaseID:FBgn0261393 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_182085.1 Gene:AT2G45610 / 819169 AraportID:AT2G45610 Length:324 Species:Arabidopsis thaliana


Alignment Length:129 Identity:30/129 - (23%)
Similarity:54/129 - (41%) Gaps:27/129 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 LPVMVYIYGGA---FTVGEATRELYGPDYFMTKDVVLVTLNYRVDCLGFLSLKDPSLKVPGNAGL 166
            ||::::::|..   :....|..:...........|::|:::||:         .|..::|  |..
plant    79 LPIIIHLHGSGWILYPANSAANDRCCSQMASELTVIVVSVHYRL---------PPEHRLP--AQY 132

  Fly   167 KDQVLALKWVK-QYISNFNG--------DDSNITVFGESAGGCSTHFMMCTEQTRGLFHKAIPM 221
            .|.:.||.||| |.:.:.||        |.|...:.| |:.|.:..|.:.   .|.|.|...|:
plant   133 DDALDALLWVKQQVVDSTNGEPWLKDYADFSRCYICG-SSNGANIAFQLA---LRSLDHDLTPL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est5NP_001246965.1 COesterase 7..510 CDD:278561 30/129 (23%)
AT2G45610NP_182085.1 Aes 57..323 CDD:223730 30/129 (23%)
Abhydrolase_3 82..303 CDD:285143 28/126 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X33
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.