DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est5 and AT2G45600

DIOPT Version :9

Sequence 1:NP_001246965.1 Gene:alpha-Est5 / 40905 FlyBaseID:FBgn0261393 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_566047.1 Gene:AT2G45600 / 819168 AraportID:AT2G45600 Length:329 Species:Arabidopsis thaliana


Alignment Length:337 Identity:64/337 - (18%)
Similarity:115/337 - (34%) Gaps:117/337 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 APVP-ADPWSGVLDCTHYAEKPTQRGLLTRE--------IEGGEDC-------LYLNVYS-KQLK 100
            ||.| :||:. .|:.|..::     |.|||.        .|..:|.       .::.::. :.:.
plant     3 APPPSSDPYK-FLNITLNSD-----GSLTRHRDFPKLPPTEQSKDIPLNQTNNTFIRIFKPRNIP 61

  Fly   101 SEKPLPVMVYIYGGAFTVGEATRELYGPDYFMTKD---VVLVTLNYRVDCLGFLSLKDPSLKVPG 162
            .|..||::||.:||.|.:..|....:........|   .:::::.||:         .|..::| 
plant    62 PESKLPILVYFHGGGFILYSAASAPFHESCTKMADRLQTIILSVEYRL---------APEHRLP- 116

  Fly   163 NAGLKDQVLALKWVK-QYISNFNGDD-----------SNITVFGESAGGCSTHFMMCTEQTRGLF 215
             |..:|.|.|:.|:: |.....||.|           |...|.|.|:||                
plant   117 -AAYEDAVEAILWLRDQARGPINGGDCDTWLKDGVDFSKCYVMGSSSGG---------------- 164

  Fly   216 HKAIPMSGTVHNYWANNPAEDFAFRLAQQNGFTGENDDAKVLEYLQGVPARDLVNHNLLTPEHRR 280
                            |...:.|.|:...:              |..|..:.|:.:...      
plant   165 ----------------NIVYNVALRVVDTD--------------LSPVKIQGLIMNQAF------ 193

  Fly   281 NGLLFAFG---PT-VEAYVGEDCVVPKPPVEMARDAWSNNFPVMLGGTSFEGLFMYPAVSANLKA 341
                  ||   |: .|:.:.:|.:.|.|...:   .||...|   .|...:.::..|..|:..:.
plant   194 ------FGGVEPSDSESRLKDDKICPLPATHL---LWSLCLP---DGVDRDHVYSNPIKSSGPQE 246

  Fly   342 LDSLSQDPTRLV 353
            .|.:.:.|:.|:
plant   247 KDKMGRFPSTLI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est5NP_001246965.1 COesterase 7..510 CDD:278561 64/337 (19%)
AT2G45600NP_566047.1 Abhydrolase_3 69..295 CDD:400284 48/265 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X33
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.