DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est5 and Bche

DIOPT Version :9

Sequence 1:NP_001246965.1 Gene:alpha-Est5 / 40905 FlyBaseID:FBgn0261393 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_075231.1 Gene:Bche / 65036 RGDID:619996 Length:597 Species:Rattus norvegicus


Alignment Length:601 Identity:155/601 - (25%)
Similarity:253/601 - (42%) Gaps:123/601 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMSKESSLETCELTLPVGQIKGVKRLSLYDDPYFSFEKIPFAKPPLGELRFRAPVPADPWSGVLD 65
            :..|..:.|...:|...|:::|:. :.:......:|..||:|:||||.|||:.|.|.:.|..|.:
  Rat    17 LFGKSHTEEDVIITTKTGRVRGLS-MPILGGTVTAFLGIPYAQPPLGSLRFKKPQPLNKWPDVYN 80

  Fly    66 CTHYAEKPTQR------GLLTREIEG-----GEDCLYLNVYSKQLKSEKPLP------VMVYIYG 113
            .|.||....|.      |....|:..     .||||||||:.       |:|      |||::||
  Rat    81 ATKYANSCYQNIDQAFPGFQGSEMWNPNTNLSEDCLYLNVWI-------PVPKPKNATVMVWVYG 138

  Fly   114 GAFTVGEATRELYGPDYFMTK--DVVLVTLNYRVDCLGFLSLKDPSLKVPGNAGLKDQVLALKWV 176
            |.|..|.::..:| ...|:|:  .|::|::||||..||||:....| :.|||.||.||.|||:|:
  Rat   139 GGFQTGTSSLPVY-DGKFLTRVERVIVVSMNYRVGALGFLAFPGNS-EAPGNMGLFDQQLALQWI 201

  Fly   177 KQYISNFNGDDSNITVFGESAGGCSTHFMMCTEQTRGLFHKAIPMSGTVHNYWANNPAEDFAFR- 240
            ::.|:.|.|:..::|:||||||..|....:...|:..||.:||..||:.:..||....|:...| 
  Rat   202 QRNIAAFGGNPKSVTLFGESAGAASVSLHLLCPQSYPLFTRAILESGSSNAPWAVKHPEEARNRT 266

  Fly   241 --LAQQNGFTGENDDAKVLEYLQGVPARDLVNHNLLTPEHRRNGLLFAFGPTVEAYVGEDCVVPK 303
              ||:..|.:.||:...:.......|...|:|..|:.|......:  .|||||:.....|  :|.
  Rat   267 LTLAKFIGCSKENEKEIITCLRSKDPQEILLNEKLVLPSDSIRSI--NFGPTVDGDFLTD--MPH 327

  Fly   304 PPVEMARDAWSNNFPVMLG-----GTSFEGLFMYPAVSANLKALDSLSQDPTRLVPVDVRTVSSE 363
            ..:::.:   .....:::|     ||:|   .:|.|        ...|:|...|:          
  Rat   328 TLLQLGK---VKTAQILVGVNKDEGTAF---LVYGA--------PGFSKDNDSLI---------- 368

  Fly   364 KENLEYSQRLMKAYFGYSPPSSELLLNMLDFYSYKIFWHG-----------------FN-----R 406
             ...|:.:.|...:.|.|....|.:|      .|.:.|.|                 :|     .
  Rat   369 -TRREFQEGLNMYFPGVSSLGKEAIL------FYYVDWLGDQTPEVYREAFDDIIGDYNIICPAL 426

  Fly   407 TFNARLTYAKAPTYYYRFDFDS-----PNFNFYRAKFCGDKIKTGVAHADDLSYLFRNAGSWKLD 466
            .|..:....:...::|.|:..|     |.:             .||.|..::.::|......:::
  Rat   427 EFTKKFAELEINAFFYYFEHRSSKLPWPEW-------------MGVMHGYEIEFVFGLPLERRVN 478

  Fly   467 KTSAEYRTIERMIGIWTAFAATSNPNCPEIGHLEWKPSTKNDPKRVINISSDVTIIDLPEYEKL- 530
            .|.||......::..|..||...:||..:.....|...|..:.| .:.::::.:.|:    .|| 
  Rat   479 YTRAEEIFSRSIMKTWANFAKYGHPNGTQGNSTVWPVFTSTEQK-YLTLNTEKSKIN----SKLR 538

  Fly   531 ----QIWDNLYKPNQL 542
                |.| .|:.|..|
  Rat   539 APQCQFW-RLFFPKVL 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est5NP_001246965.1 COesterase 7..510 CDD:278561 145/556 (26%)
BcheNP_075231.1 COesterase 21..545 CDD:278561 150/586 (26%)
Aes <120..>272 CDD:223730 60/160 (38%)
AChE_tetra 560..594 CDD:285837
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100080
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.