DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est5 and NLGN2

DIOPT Version :9

Sequence 1:NP_001246965.1 Gene:alpha-Est5 / 40905 FlyBaseID:FBgn0261393 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_065846.1 Gene:NLGN2 / 57555 HGNCID:14290 Length:835 Species:Homo sapiens


Alignment Length:604 Identity:158/604 - (26%)
Similarity:249/604 - (41%) Gaps:139/604 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GQIKGVKRLSLYDD---PYFSFEKIPFAKPPLGELRFRAPVPADPWSGVLDCTHYAEKPTQ--RG 77
            |:::||:| .|.::   |...|..:|:|.||||..||:.|.....|.||.:.|.......|  .|
Human    49 GRVRGVRR-ELNNEILGPVVQFLGVPYATPPLGARRFQPPEAPASWPGVRNATTLPPACPQNLHG 112

  Fly    78 LL---------TREIEG--------GEDCLYLNVY--------------------SKQLKSEKPL 105
            .|         |..:|.        .|||||||:|                    ...::.....
Human   113 ALPAIMLPVWFTDNLEAAATYVQNQSEDCLYLNLYVPTEDGPLTKKRDEATLNPPDTDIRDPGKK 177

  Fly   106 PVMVYIYGGAFTVGE------ATRELYGPDYFMTKDVVLVTLNYRVDCLGFLSLKDPSLKVPGNA 164
            |||::::||::..|.      :....||       :|::.|||||:..|||||..|.:.|  ||.
Human   178 PVMLFLHGGSYMEGTGNMFDGSVLAAYG-------NVIVATLNYRLGVLGFLSTGDQAAK--GNY 233

  Fly   165 GLKDQVLALKWVKQYISNFNGDDSNITVFGESAGGCSTHFMMCTEQTRGLFHKAIPMSGTVHNYW 229
            ||.||:.||:|:.:.|::|.||...||:||..||....:.::.:..:.|||.|||..|||..:.|
Human   234 GLLDQIQALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQKAIAQSGTAISSW 298

  Fly   230 ANN--PAEDFAFRLAQQNGFTGENDDAKVLEYLQGVPARDLVNHNLLTPEHRRNGLLFAFGPTVE 292
            :.|  |.: :...||.:.|...| |.|:.:|.|:..|:|:||:.::....:.     .||||.|:
Human   299 SVNYQPLK-YTRLLAAKVGCDRE-DSAEAVECLRRKPSRELVDQDVQPARYH-----IAFGPVVD 356

  Fly   293 AYVGEDCVVPKPPVEMARDAWSNNFPVMLGGTSFEGLFMYPAVSANLKALDSLSQDPTRLVPVDV 357
               |:  |||..|..:.:.....|:.:::|....||| .:...||.       |:|.......|.
Human   357 ---GD--VVPDDPEILMQQGEFLNYDMLIGVNQGEGL-KFVEDSAE-------SEDGVSASAFDF 408

  Fly   358 RTVSSEKENLEYSQRLMKAYFGYSPPSSELLLNMLDFYSYKIFWHGFNRTFNARLTYA------- 415
             |||:..:||          :|| |...::|...:.| .|..:....|.....:...|       
Human   409 -TVSNFVDNL----------YGY-PEGKDVLRETIKF-MYTDWADRDNGEMRRKTLLALFTDHQW 460

  Fly   416 --------------KAPTYYYRFDFDSPNFNFYRAKFCGDKIKTGVAHADDLSYLFRNAGSWKLD 466
                          ::|.|:|.|        ::..:..|.......||.|:|.|:|........|
Human   461 VAPAVATAKLHADYQSPVYFYTF--------YHHCQAEGRPEWADAAHGDELPYVFGVPMVGATD 517

  Fly   467 KTSAEYRTIERMIG-----IWTAFAATSNPNCP---EIGHLEWKPST---------KNDPKRVIN 514
            .....:...:.|:.     .||.||.|.:||.|   :...:..||:.         .:..|:.::
Human   518 LFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVVWSKFNSKEKQYLH 582

  Fly   515 ISSDVTIIDLPEYEKLQIW 533
            |.....:.|.....|:..|
Human   583 IGLKPRVRDNYRANKVAFW 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est5NP_001246965.1 COesterase 7..510 CDD:278561 153/579 (26%)
NLGN2NP_065846.1 COesterase 41..601 CDD:278561 157/602 (26%)
Aes <170..>268 CDD:223730 39/106 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 623..668
Required for interaction with LHFPL4. /evidence=ECO:0000250|UniProtKB:Q69ZK9 678..698
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 790..835
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142788
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.