DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est5 and si:dkey-193c22.1

DIOPT Version :9

Sequence 1:NP_001246965.1 Gene:alpha-Est5 / 40905 FlyBaseID:FBgn0261393 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001093504.1 Gene:si:dkey-193c22.1 / 567837 ZFINID:ZDB-GENE-030131-7957 Length:370 Species:Danio rerio


Alignment Length:275 Identity:61/275 - (22%)
Similarity:102/275 - (37%) Gaps:62/275 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 QLKSEKPLPVMVYIYGGAFTVGEATRELYGPDYFMTKDVVLVTLNYRVDCLGFLSLKDPSLKVPG 162
            :|..|.|:||:|::||||:  |...|.:|          .|:.|....:....:...|.|:...|
Zfish   111 ELSDESPVPVVVFVYGGAW--GSGDRSIY----------CLLALQMAKELNASVICPDYSIYPKG 163

  Fly   163 NA-----GLKDQVLALKWVKQYISNFNGDDSNITVFGESAGG--CSTHFMMCTEQTRGLFHKAIP 220
            |.     .:.|.:|   ||:|....|:.|..||.:.|.|||.  |:...:........||.:   
Zfish   164 NVLNMVQDISDSLL---WVRQKGHAFSLDQDNIILIGHSAGAHLCALTSLFLASNVEELFIE--- 222

  Fly   221 MSGTVHNYWANNPAEDFAFRLAQQNGFTG--------ENDDAKVLEY-------LQGVPARDLVN 270
                      .|..:|....:....|.:|        .::..:.:||       :.||...|..:
Zfish   223 ----------TNKQKDLVTAIKGIIGLSGVYSIMDHYNHEKVRAVEYVSTMHKAMDGVENFDYYS 277

  Fly   271 HNLLTPEHRRNGLLFAFGPTVEAYVG-EDCVVPKPPVEMARDAWSNNFPVMLGGTSFE-GLFMYP 333
            ...|..:.:.:.|...  |.:..:.| .|.:|   |||.     |..|..:|...|.. .|::.|
Zfish   278 PTSLLKKMKEDQLKRV--PPMALFHGTNDIIV---PVES-----SVRFSELLTSLSIRMSLYLIP 332

  Fly   334 AVSANLKALDSLSQD 348
            .::......|.::.|
Zfish   333 KMNHTDMVTDLMAPD 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est5NP_001246965.1 COesterase 7..510 CDD:278561 61/275 (22%)
si:dkey-193c22.1NP_001093504.1 Aes 87..336 CDD:223730 59/262 (23%)
Abhydrolase 121..>210 CDD:304388 28/103 (27%)
Abhydrolase 167..336 CDD:304388 40/194 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.