DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est5 and NLGN3

DIOPT Version :9

Sequence 1:NP_001246965.1 Gene:alpha-Est5 / 40905 FlyBaseID:FBgn0261393 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_851820.1 Gene:NLGN3 / 54413 HGNCID:14289 Length:848 Species:Homo sapiens


Alignment Length:636 Identity:161/636 - (25%)
Similarity:242/636 - (38%) Gaps:174/636 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GQIKGVKRLSLYDD---PYFSFEKIPFAKPPLGELRFRAPVPADPWSGVLDCTHYAEK-PTQRGL 78
            |:::|. |:.|..:   |...:..:|:|.||:||.||..|.|...|||:.:.||:... |.....
Human    49 GKLRGA-RVPLPSEILGPVDQYLGVPYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHT 112

  Fly    79 LTREI------------------EGGEDCLYLNVY-----SKQLKSE---KP------------- 104
            ...|:                  |..|||||||||     .|::..|   ||             
Human   113 AVPEVMLPVWFTANLDIVATYIQEPNEDCLYLNVYVPTEDVKRISKECARKPNKKICRKGGSGAK 177

  Fly   105 ----------------------LPVMVYIYGGAFTVGEATR------ELYGPDYFMTKDVVLVTL 141
                                  .||||||:||::..|....      ..||       :|:::||
Human   178 KQGEDLADNDGDEDEDIRDSGAKPVMVYIHGGSYMEGTGNMIDGSILASYG-------NVIVITL 235

  Fly   142 NYRVDCLGFLSLKDPSLKVPGNAGLKDQVLALKWVKQYISNFNGDDSNITVFGESAGGCSTHFMM 206
            ||||..|||||..|.:.|  ||.||.||:.||:||.:.|:.|.||...|||||...|......:.
Human   236 NYRVGVLGFLSTGDQAAK--GNYGLLDQIQALRWVSENIAFFGGDPRRITVFGSGIGASCVSLLT 298

  Fly   207 CTEQTRGLFHKAIPMSGTVHNYWANN--PAEDFAFRLAQQNGFTGENDDAKVLEYLQGVPARDLV 269
            .:..:.|||.:||..||:..:.||.|  |.: :...||.:.| ....|...:::.|:...|::||
Human   299 LSHHSEGLFQRAIIQSGSALSSWAVNYQPVK-YTSLLADKVG-CNVLDTVDMVDCLRQKSAKELV 361

  Fly   270 NHNLLTPEHRRNGLLFAFGPTVEAYVGEDCVVPKPPVEMARDAWSNNFPVMLGGTSFEGLFMYPA 334
            ..::....:.     .||||.::   |:  |:|..|..:.......|:.:|||....|||.....
Human   362 EQDIQPARYH-----VAFGPVID---GD--VIPDDPEILMEQGEFLNYDIMLGVNQGEGLKFVEG 416

  Fly   335 VSANLKALDSLSQDPTRLVPVDVRTVSSEKENLEYSQRLMKAYFGYSPPSSELLLNMLDF-YSYK 398
            |......:.....|         .:||:..:||          :|| |...:.|...:.| |:  
Human   417 VVDPEDGVSGTDFD---------YSVSNFVDNL----------YGY-PEGKDTLRETIKFMYT-- 459

  Fly   399 IFWHGFNRTFNARLT--------------------YAK--APTYYYRFDFDSPNFNFYRAKFCGD 441
             .|...:.....|.|                    :|:  :|||:|.         ||.  .|..
Human   460 -DWADRDNPETRRKTLVALFTDHQWVEPSVVTADLHARYGSPTYFYA---------FYH--HCQS 512

  Fly   442 KIK---TGVAHADDLSYLFRNAGSWKLDKTSAEYRTIERMIG-----IWTAFAATSNPNCP---- 494
            .:|   :..||.|::.|:|........|.....:...:.|:.     .||.||.|.:||.|    
Human   513 LMKPAWSDAAHGDEVPYVFGVPMVGPTDLFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNKPVPQD 577

  Fly   495 ---------EIGHLEWKPSTKNDPKRVINISSDVTIIDLPEYEKLQIWDNL 536
                     ....:.|......| :..::|.....:.|.....|:..|.:|
Human   578 TKFIHTKANRFEEVAWSKYNPRD-QLYLHIGLKPRVRDHYRATKVAFWKHL 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est5NP_001246965.1 COesterase 7..510 CDD:278561 156/608 (26%)
NLGN3NP_851820.1 COesterase 36..624 CDD:278561 159/631 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..195 0/24 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 645..694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142584
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.