DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est5 and Cesl1

DIOPT Version :9

Sequence 1:NP_001246965.1 Gene:alpha-Est5 / 40905 FlyBaseID:FBgn0261393 Length:543 Species:Drosophila melanogaster
Sequence 2:XP_038953870.1 Gene:Cesl1 / 501232 RGDID:1565666 Length:596 Species:Rattus norvegicus


Alignment Length:608 Identity:172/608 - (28%)
Similarity:259/608 - (42%) Gaps:137/608 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLETCEL-----TLPV-----GQIKGVKRLSL--YDDPYFSFEKIPFAKPPLGELRFRAPVPADP 59
            ||.||.:     :.||     |::.| |..||  .......|..:||||||||.|||..|.||:|
  Rat    45 SLATCVVCGNPSSPPVVDTMKGKVLG-KYASLEGVTQSVAVFLGVPFAKPPLGSLRFAPPQPAEP 108

  Fly    60 WSGVLDCTHYAEKPTQ--------RGLLTR-----EIEGGEDCLYLNVYS-KQLKSEKPLPVMVY 110
            ||.|.:.|.|....:|        ..|||.     .::..|||||||:|: .....:..:||||:
  Rat   109 WSFVKNTTTYPPMCSQDATKGQRMNDLLTNRKEKVHLQFSEDCLYLNIYTPADFTKDSRMPVMVW 173

  Fly   111 IYGGAFTVGEATRELY-GPDYFMTKDVVLVTLNYRVDCLGFLSLKDPSLKVPGNAGLKDQVLALK 174
            |:||..|.|.|:  .| |......::||:|.:.||:...||.|..|...:  ||.|..|||.||.
  Rat   174 IHGGGLTQGGAS--TYDGQVLSAYENVVVVAIQYRLGIWGFFSTGDEHSR--GNWGHLDQVAALH 234

  Fly   175 WVKQYISNFNGDDSNITVFGESAGGCSTHFMMCTEQTRGLFHKAIPMSGTV--HNYWANN--PAE 235
            ||:..|:||.||..::|:|||||||.|...::.:..::.|:|:||..||.|  ...:..:  || 
  Rat   235 WVQDNIANFGGDPGSVTIFGESAGGFSVSVLVLSPLSKNLYHRAISESGVVLITELFTKDVRPA- 298

  Fly   236 DFAFRLAQQNG-----------FTGENDDAKVLEYLQGVPARDLVNHNLLTPEHRRNGLLFAFGP 289
              |.::|...|           ...:..:.::||.::.:        ||:....:|:        
  Rat   299 --AKQIADMAGCKTTTSAIIVHCLRQKTEEELLEIMEKM--------NLIKLSSQRD-------- 345

  Fly   290 TVEAY-----VGEDCVVPKPPVEMARDAWSNNFPVMLGGTSFE--------GLFMYPAVSANLKA 341
            |.|:|     |.:|.|:||.|.|:..:...|..|.::|....|        ..|:.|.|..:.|.
  Rat   346 TKESYHFLSTVIDDVVLPKDPKEILAEKNFNTVPYIVGINKQECGWLLPTMMRFVPPDVKLDKKM 410

  Fly   342 LDSLSQDPTRL--VPVDVRTVSSEK------ENLEYSQRLMKAYFG---YSPPSSELLLNMLDFY 395
            ...|.:....:  :|.|:..|:.||      :.::....:: |:.|   :..||..:..:..|  
  Rat   411 AIMLLEKFASIYGIPEDIIPVAIEKYRKGSDDPIKIRDGIL-AFIGDALFCIPSVMVSRDHRD-- 472

  Fly   396 SYKIFWHGFNRTFNARLTYAKAPTYYYRF----DFDSPNFNFYRAK-FCGDKIKTGVAHADDLSY 455
                               |.||||.|.:    .|.||.    |.| ..||       ||||:..
  Rat   473 -------------------AGAPTYVYEYQYYPSFSSPQ----RPKDVVGD-------HADDVYS 507

  Fly   456 LFRNAGSWKL-DKTSAEYRTIERMI-GIWTAFAATSNPNCPEIGHLEWKPSTKNDPKRVINISSD 518
            :|   |:..| |..|.|...:.:|: ..|..||...|||...:.|  |....:.:  ..:.|.:.
  Rat   508 VF---GAPILRDGASEEEIKLSKMVMKFWANFARNGNPNGRGLPH--WPQYDQKE--EYLQIGAT 565

  Fly   519 VTIIDLPEYEKLQIWDNLYKPNQ 541
            .......:.|::..|..|....|
  Rat   566 TQQSQGLKAEEVAFWTQLLAKRQ 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est5NP_001246965.1 COesterase 7..510 CDD:278561 167/575 (29%)
Cesl1XP_038953870.1 COesterase 57..580 CDD:395084 165/586 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100080
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.