DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est5 and Nrt

DIOPT Version :9

Sequence 1:NP_001246965.1 Gene:alpha-Est5 / 40905 FlyBaseID:FBgn0261393 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001189121.1 Gene:Nrt / 39873 FlyBaseID:FBgn0004108 Length:846 Species:Drosophila melanogaster


Alignment Length:381 Identity:105/381 - (27%)
Similarity:168/381 - (44%) Gaps:70/381 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GQIKGVKRLSLYDDPYFSFEKIPFAKPPLGELRFRAPVPAD-------PWSGVLDCTHYAEKPTQ 75
            |.::|||     :|..|:|..||:||||:..||::   ||:       .|:..|. ||.:.....
  Fly   368 GPVEGVK-----EDGAFAFRGIPYAKPPVDRLRWK---PAELIDDINMCWNDTLQ-THNSSVVCT 423

  Fly    76 RGLLTREIEGGEDCLYLNVYSKQLKSEKPLPVMVYIYGGAFTVGEATRELYGPD--YFMTKDVVL 138
            :.|......|.||||||:|.:..::...||||:|.|  ||.::...:..:..|.  |..:.||:.
  Fly   424 QRLGNGTTVGDEDCLYLDVVTPHVRYNNPLPVVVLI--GAESLAGPSPGILRPSARYSRSHDVIF 486

  Fly   139 VTLNYRVDCLGFLSL----KDPSLKVPGNAGLKDQVLALKWVKQYISNFNGDDSNITVFGESAGG 199
            |..|:|:...|||:|    |:......||..|.|.:..|.|:|..|.:|.||..::|:.|..||.
  Fly   487 VRPNFRLGVFGFLALDALTKEAHPPTSGNYALTDIIAVLNWIKLNIVHFGGDPQSVTLLGHRAGA 551

  Fly   200 CSTHFMMCTEQTRGLFHKAIPMSGTVHNYWANNPAEDFAFRLAQQNGFTGENDDAKVLEYLQGVP 264
            .....::.:::.:||:.:|          ||::.:.....:...::|...|...| .||......
  Fly   552 TLVTLLVNSQKVKGLYTRA----------WASSGSAILPGKPLSESGKQNEQLMA-TLECADIQC 605

  Fly   265 ARDLVNHNL--LTPEHRRNGLLF-----------AFGPTVEAYVGEDCVVPKPPVEMARDAWSNN 316
            .|:..:..|  .||:   ..|.|           |.|...|..|.:..||.:.|.:..:...:|:
  Fly   606 LREASSERLWAATPD---TWLHFPVDLPQPQEANASGSRHEWLVLDGDVVFEHPSDTWKREQAND 667

  Fly   317 FPVM-LGGTSFEGLFMYPAVSANLKALDSLSQDPTRLVPVDVRTVSSEKENLEYSQ 371
            .||: :|.|:.|         |:.:.|..|..:.||   .:||..      ||.||
  Fly   668 KPVLVMGATAHE---------AHTEKLRELHANWTR---EEVRAY------LENSQ 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est5NP_001246965.1 COesterase 7..510 CDD:278561 105/381 (28%)
NrtNP_001189121.1 Abhydrolase 362..832 CDD:304388 105/381 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.