DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est5 and Jhedup

DIOPT Version :9

Sequence 1:NP_001246965.1 Gene:alpha-Est5 / 40905 FlyBaseID:FBgn0261393 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_611085.2 Gene:Jhedup / 36779 FlyBaseID:FBgn0034076 Length:559 Species:Drosophila melanogaster


Alignment Length:586 Identity:177/586 - (30%)
Similarity:264/586 - (45%) Gaps:109/586 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLETCELTLPVGQIKGVKRLSLYDDPYFSFEKIPFAKPPLGELRFRAPVPADPWSGVLDCTHYAE 71
            ||:.|  ...:|.::|..........:.:|..||||:||:|.||.:.|||.:||.||||.....:
  Fly    19 SLDVC--LEDMGCMRGTLMPGYQSGEFEAFMGIPFAQPPVGPLRLKNPVPNEPWEGVLDAGAAKD 81

  Fly    72 KPTQRGLLTRE--IEGGEDCLYLNVYSKQLKSEKPLPVMVYIYGGAFTVGEATRELYGPDYFM-T 133
            ...||....:|  :.|.|||||||||..:.::|..|||||||:||.|..|.|.....||:|.| |
  Fly    82 SCIQRSYFAKEWGLMGVEDCLYLNVYRPKNRAEDKLPVMVYIHGGGFFSGSAHPMASGPEYLMDT 146

  Fly   134 KDVVLVTLNYRVDCLGFLSLKDPSLKVPGNAGLKDQVLALKWVKQYISNFNGDDSNITVFGESAG 198
            ..||:||:|||:...||||..|..:  |||.|.|||.|||:|::::|:.|.||...:||.|.|||
  Fly   147 NKVVMVTMNYRLGPFGFLSTGDEHM--PGNFGFKDQRLALQWIQKHIATFGGDPKKVTVLGHSAG 209

  Fly   199 GCSTHFMMCTEQTRGLFHKAIPMSGTVH--------------NYWANNPAEDFAFRLAQQNGFTG 249
            |.|.|..|.:..::|||..::.::||:.              .......|.|.|..|:.|:    
  Fly   210 GISAHLHMISPNSKGLFQNSMSLTGTMFLSAMKILKDPLSQARRLGKELAIDQAESLSSQD---- 270

  Fly   250 ENDDAKVLEYLQGV-PARDLVNHNLL-----TPEHRRNGLLFAFGPTVEAYVGEDCVVPKPPVEM 308
                  :.|.|:.| |.:.||:.:.|     .|......:|.|  |:.:|::.||      |::.
  Fly   271 ------LAEALRNVCPKKLLVSVDSLKVWDNMPHLTTLPVLEA--PSPDAFLVED------PLDA 321

  Fly   309 ARDAWSNNFPVMLGGTSFEG---LFMYPA-VSANLKALDSLSQDPTRLVPVDVRTVSSEKEN-LE 368
            .|....|..|.:|..:|..|   ||:..| ::..|:|                    ...|| ||
  Fly   322 HRAGRINQMPWILSLSSRAGEGSLFIMRAFINPKLRA--------------------EFNENFLE 366

  Fly   369 YSQRLMKAYFGYSPPSSELLLNMLDFYSYK-------------------IFWHGFNRTFNARLTY 414
            :...|:....| :|  .:::..:||.|.:|                   .|::....|.::.:||
  Fly   367 HMALLLNLPEG-TP--VQMVSEILDAYDFKGDSLNNDTMLKLAEISGDFNFYYPIYETISSYVTY 428

  Fly   415 A---KAPTYYYRFDFDSPNFNFYRAKFCG--DKIKTGVAHADDLSYLFRNAGSW-KLDKTSAEYR 473
            |   :.|.:.|.|:|  ...|.....|.|  |....|..|.||..:..|...|: ...|.|.:.:
  Fly   429 ANLEENPLFIYIFEF--AGLNSITKFFAGTTDDYGLGAVHMDDGLHTIRIPVSFDDFPKDSEDAK 491

  Fly   474 TIERMIGIWTAFAAT----SNPNC-----PEIGHLEWKPSTKNDPKRVINISSDVTIIDLPEYEK 529
            .|:||..:.|.||.|    ....|     .|.|...:.....|..|.:.:|.:.:|:...|.::|
  Fly   492 VIQRMSSLMTDFAKTGVFHEESICKVSDFKEQGMCNYLHFGGNKEKYLEDIRNSITLTAFPIWKK 556

  Fly   530 L 530
            |
  Fly   557 L 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est5NP_001246965.1 COesterase 7..510 CDD:278561 171/564 (30%)
JhedupNP_611085.2 COesterase 31..508 CDD:278561 163/521 (31%)
Aes <106..>210 CDD:223730 52/105 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440397
Domainoid 1 1.000 98 1.000 Domainoid score I1867
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1664
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D206516at33208
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X33
87.800

Return to query results.
Submit another query.