DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est5 and Nlg2

DIOPT Version :9

Sequence 1:NP_001246965.1 Gene:alpha-Est5 / 40905 FlyBaseID:FBgn0261393 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001245916.1 Gene:Nlg2 / 33962 FlyBaseID:FBgn0031866 Length:1248 Species:Drosophila melanogaster


Alignment Length:634 Identity:135/634 - (21%)
Similarity:214/634 - (33%) Gaps:217/634 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SFEKIPFAKPPLGELRFRAPVPADPWSGVLDCTHYA------------------EKPTQRGLLTR 81
            :|..||:|.||:|.|||..|:....|..|.....::                  |.|..|....|
  Fly   205 AFLGIPYASPPVGSLRFMPPITPSTWKTVRSADRFSPVCPQNIPIPPNGPEALLEVPRARLAQLR 269

  Fly    82 EI-----EGGEDCLYLNVY-----SKQLKS--------EKPLPVMVYIYGGAFTVGEATRELYGP 128
            .:     ...|||||||:|     .:|.::        :..|..:|:|:|.::. ..:.....|.
  Fly   270 RLLPLLKNQSEDCLYLNIYVPYETRRQRRNTDDTTGEPKTKLSTVVFIHGESYD-WNSGNPYDGS 333

  Fly   129 DYFMTKDVVLVTLNYRVDCLGFLSLKDPSLKVPGNAGLKDQVLALKWVKQYISNFNGDDSNITVF 193
            :.....:|::||:|:|:...|||...... ...||.||.|.|..|.|:|:.:..|.||..:||:.
  Fly   334 ELAAHGNVIVVTINFRLGIFGFLKTGGKE-SAQGNFGLMDLVAGLHWLKENLPAFGGDPQSITLL 397

  Fly   194 GESAGGCSTHFMMCTEQTRGLFHKAIPMSGTVHNYWA--NNPAEDFAF---RLAQQNGFTGE--- 250
            |...|....:.::.:.....|..:.:.:||:..:.||  .||    .|   |:|:|.|..|:   
  Fly   398 GYGTGAVLANILVVSPVASDLIQRTVLVSGSALSPWAIQKNP----LFVKRRVAEQTGCHGDMLY 458

  Fly   251 NDDAKVLEYLQGVPARDLVNHNLLTPEHRRNGLLFAFGPTVEAYVGEDCVVPKPPVEMARDAWSN 315
            :|.|..|.      .:.:.....:..:|.|  .|..|.|.|:..|......|             
  Fly   459 DDLAPCLR------TKSVAELLAVKVDHPR--FLVGFAPFVDGTVISPGANP------------- 502

  Fly   316 NFPVMLGGTSFEGLFMYPAVSANLKALDSLSQDPTRLVPVDVRTVSSEKENLEYSQRLMKAYFGY 380
                 ||.|:                           :|:....||:  ..:||      |.|  
  Fly   503 -----LGSTT---------------------------LPLGSAIVST--SGIEY------ANF-- 525

  Fly   381 SPPSSELLLNMLDFYSY-----KIFWHGFNRTFNARL--TYAKAPTYYYRFDFDSPNFNFY---- 434
              |..:|:..:....||     :....|||.|...|:  |:.:...:|:..:..:...|.|    
  Fly   526 --PKRDLIFCLTSVESYLDLSAQDLEFGFNETRRDRILRTFVRNNFHYHLNEIFAVLKNEYTDWE 588

  Fly   435 --------------------------------------RAKFCGDKIKT---------GVAHADD 452
                                                  ||.|...|.||         |....:|
  Fly   589 KAIRNPLSSRDATLQFLSDGHTASPLIKLGYMHSLRGGRAYFLHFKHKTIEEEYPQRSGSVRGED 653

  Fly   453 --------LSYLFRNAGSWKLDKTSAEYRTIERMIG-----IWTAFAATSNPNCPEIGHLEWKPS 504
                    :|.||.:           .|.|.||.||     ..:.||.|.|||         :.:
  Fly   654 VPFWLGLPMSPLFPH-----------NYTTQERQIGRLMLRYLSNFAKTGNPN---------QST 698

  Fly   505 TKN---DPKRVINI--------SSDVTIIDLPEYEKLQIWDNLYKPNQL 542
            .|:   :|..|:..        |:.:|..:|.|...|.:..|..:.|.:
  Fly   699 AKSVLPNPNEVLETALHQQKKRSTSLTHPNLSEALNLAVLYNQRRSNAM 747

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est5NP_001246965.1 COesterase 7..510 CDD:278561 126/592 (21%)
Nlg2NP_001245916.1 COesterase 182..712 CDD:278561 128/597 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.