DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est5 and NLGN1

DIOPT Version :9

Sequence 1:NP_001246965.1 Gene:alpha-Est5 / 40905 FlyBaseID:FBgn0261393 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001352852.1 Gene:NLGN1 / 22871 HGNCID:14291 Length:843 Species:Homo sapiens


Alignment Length:568 Identity:160/568 - (28%)
Similarity:243/568 - (42%) Gaps:143/568 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GQIKGVKRLSLYDD---PYFSFEKIPFAKPPLGELRFRAPVPADPWSGVLDCTHYAEKPTQR--- 76
            |:|:|:|: .|.::   |...|..:|:|.||.||.||:.|.|..|||.:.:.|.:|....|.   
Human    60 GKIRGIKK-ELNNEILGPVIQFLGVPYAAPPTGERRFQPPEPPSPWSDIRNATQFAPVCPQNIID 123

  Fly    77 GLLTREI-----------------EGGEDCLYLNVY---------SKQL---------------K 100
            |.|...:                 :..|||||||:|         .||.               .
Human   124 GRLPEVMLPVWFTNNLDVVSSYVQDQSEDCLYLNIYVPTEDGPLTKKQTDDLGDNDGAEDEDIRD 188

  Fly   101 SEKPLPVMVYIYGGAFTVGEATRELY-GPDYFMTKDVVLVTLNYRVDCLGFLSLKDPSLKVPGNA 164
            |..|.||||||:||::.  |.|..|| |.......:|:::|:|||:..|||||..|.:.|  ||.
Human   189 SGGPKPVMVYIHGGSYM--EGTGNLYDGSVLASYGNVIVITVNYRLGVLGFLSTGDQAAK--GNY 249

  Fly   165 GLKDQVLALKWVKQYISNFNGDDSNITVFGESAGGCSTHFMMC---------TEQTRGLFHKAIP 220
            ||.|.:.||:|..:.|..|.||...|||||..|||...:.:..         :..|:|||.:||.
Human   250 GLLDLIQALRWTSENIGFFGGDPLRITVFGSGAGGSCVNLLTLSHYSEGNRWSNSTKGLFQRAIA 314

  Fly   221 MSGTVHNYWANN--PAEDFAFRLAQQNGFTGENDDAKVLEYLQGVPARDLVNHNLLTPEHRRNGL 283
            .|||..:.||.:  ||: :|..||.:.| ...:|..:::|.||..|.::||:.::....:.    
Human   315 QSGTALSSWAVSFQPAK-YARMLATKVG-CNVSDTVELVECLQKKPYKELVDQDIQPARYH---- 373

  Fly   284 LFAFGPTVEAYVGEDCVVPKPPVEMARDAWSNNFPVMLGGTSFEGLFMYPAVSANLKALDSL--S 346
             .||||.::   |:  |:|..|..:.......|:.:|||....||          ||.::::  |
Human   374 -IAFGPVID---GD--VIPDDPQILMEQGEFLNYDIMLGVNQGEG----------LKFVENIVDS 422

  Fly   347 QDPTRLVPVDVRTVSSEKENLEYSQRLMKAYFGYSPPSSELLLNMLDFYSYKIFWHGFN-----R 406
            .|.......|. .||:..:||          :|| |...::|...:.| .|..:....|     :
Human   423 DDGISASDFDF-AVSNFVDNL----------YGY-PEGKDVLRETIKF-MYTDWADRHNPETRRK 474

  Fly   407 TFNARLTYAK----------------APTYYYRFDFDSPNFNFYRAKFCGDKIK--TGVAHADDL 453
            |..|..|..:                :|||:|.|        ::..:  .|::.  ...||.|::
Human   475 TLLALFTDHQWVAPAVATADLHSNFGSPTYFYAF--------YHHCQ--TDQVPAWADAAHGDEV 529

  Fly   454 SYL--FRNAGSWKL-----DKTSAEYRTIERMIGIWTAFAATSNPNCP 494
            .|:  ....|..:|     .|.......:  ::..||.||.|.:||.|
Human   530 PYVLGIPMIGPTELFPCNFSKNDVMLSAV--VMTYWTNFAKTGDPNQP 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est5NP_001246965.1 COesterase 7..510 CDD:278561 160/568 (28%)
NLGN1NP_001352852.1 COesterase 53..626 CDD:365897 160/568 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142648
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.