DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est5 and CES5A

DIOPT Version :9

Sequence 1:NP_001246965.1 Gene:alpha-Est5 / 40905 FlyBaseID:FBgn0261393 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001177087.1 Gene:CES5A / 221223 HGNCID:26459 Length:604 Species:Homo sapiens


Alignment Length:540 Identity:155/540 - (28%)
Similarity:231/540 - (42%) Gaps:108/540 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SKES--SLETCELTLPVGQIKGVKRLSLYDD--PYFSFEKIPFAKPPLGELRFRAPVPADPWSGV 63
            ||:.  |.|..:....:|.|:| |::::...  |...|..:|||.||||.|||..|.||.||..:
Human    50 SKDEGPSAEGPQRNTRLGWIQG-KQVTVLGSPVPVNVFLGVPFAAPPLGSLRFTNPQPASPWDNL 113

  Fly    64 LDCTHYAEKPTQRG---LLTR--------EIEGGEDCLYLNVYS-KQLKSEKPLPVMVYIYGGAF 116
            .:.|.|.....|..   ||.:        :....|||||||:|: ....:...|||:|:..||||
Human   114 REATSYPNLCLQNSEWLLLDQHMLKVHYPKFGVSEDCLYLNIYAPAHADTGSKLPVLVWFPGGAF 178

  Fly   117 TVGEATRELY-GPDYFMTKDVVLVTLNYRVDCLGFLSLKDPSLKVPGNAGLKDQVLALKWVKQYI 180
            ..|.|:  :: |......:||::|.:.||:...||.:..|.  ..|||...||||.||.||::.|
Human   179 KTGSAS--IFDGSALAAYEDVLVVVVQYRLGIFGFFTTWDQ--HAPGNWAFKDQVAALSWVQKNI 239

  Fly   181 SNFNGDDSNITVFGESAGGCSTHFMMCTEQTRGLFHKAIPMSGT-------VHNYWANNPAEDFA 238
            ..|.||.|::|:||||||..|...::.:...:|||||||..||.       .|:|   ..:||  
Human   240 EFFGGDPSSVTIFGESAGAISVSSLILSPMAKGLFHKAIMESGVAIIPYLEAHDY---EKSED-- 299

  Fly   239 FRLAQQNGFTGEN--DDAKVLEYLQGVPARDLVNHNLLTPEHRR--NGLLFAFGPTVEAYVGEDC 299
              |.....|.|.|  |...:|..|:..|:::|:..:..|....|  :|..|              
Human   300 --LQVVAHFCGNNASDSEALLRCLRTKPSKELLTLSQKTKSFTRVVDGAFF-------------- 348

  Fly   300 VVPKPPVEMARDAWSNNFPVMLGGTSFEGLFMYP------AVSANLKALD-SLSQDPTRLVPVDV 357
              |..|:::.........|.::|..:.|..|:.|      .:|.:.|:|. .|.|:...:.|..:
Human   349 --PNEPLDLLSQKAFKAIPSIIGVNNHECGFLLPMKEAPEILSGSNKSLALHLIQNILHIPPQYL 411

  Fly   358 RTVSSEKENLEYSQRLMKAYFGYSPPSSELLLNMLDFYSYKIFWHGFNRTFNARLTY-----AKA 417
            ..|::|             ||......:|:..::||......|      ...|.:|.     |.|
Human   412 HLVANE-------------YFHDKHSLTEIRDSLLDLLGDVFF------VVPALITARYHRDAGA 457

  Fly   418 PTYYYRFDFDSPNFNFYRAKFCGDKIKTGVAHADDLSYLFRNA----------GSWKLDKTSAEY 472
            |.|:|.|......|...:..|    :|..  |||::.::|..|          |:     |..|.
Human   458 PVYFYEFRHRPQCFEDTKPAF----VKAD--HADEVRFVFGGAFLKGDIVMFEGA-----TEEEK 511

  Fly   473 RTIERMIGIWTAFAATSNPN 492
            ....:|:..|..||.|.|||
Human   512 LLSRKMMKYWATFARTGNPN 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est5NP_001246965.1 COesterase 7..510 CDD:278561 153/534 (29%)
CES5ANP_001177087.1 COesterase 56..568 CDD:278561 153/534 (29%)
Aes <155..>258 CDD:223730 42/106 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142606
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 216 1.000 Inparanoid score I3612
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100080
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.690

Return to query results.
Submit another query.