DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est5 and cest-5.1

DIOPT Version :9

Sequence 1:NP_001246965.1 Gene:alpha-Est5 / 40905 FlyBaseID:FBgn0261393 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_501022.3 Gene:cest-5.1 / 177429 WormBaseID:WBGene00015279 Length:580 Species:Caenorhabditis elegans


Alignment Length:199 Identity:68/199 - (34%)
Similarity:101/199 - (50%) Gaps:9/199 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YFSFEKIPFAKPPLGELRFRAPVPADPWSGVLDCTHYAEKPTQRGLLTREIEG--GEDCLYLNVY 95
            |..|:||||||||:|.|||:.|..|..|.|:.....|..........|:..:.  .||||::|::
 Worm    36 YHLFKKIPFAKPPVGNLRFQKPEAAGKWDGIRSAIEYGPACMSNSSKTKSPQKWVDEDCLHVNIF 100

  Fly    96 -SKQLKSEKPLPVMVYIYGGAFTVGEAT--RELYGPDYFMTKDVVLVTLNYRVDCLGFLSLKDPS 157
             ||:....:...:.|||:||..|...|.  .:....|.|:.:||:||...:|:......::.:.:
 Worm   101 TSKKCLKSRNCAIAVYIHGGGLTYDSAVMFNDTVLLDTFVKRDVILVIPGFRLGIFSHFTVHNQN 165

  Fly   158 LKVPGNAGLKDQVLALKWVKQYISNFNGDDSNITVFGESAGGCSTHFMMCTEQTR---GLFHKAI 219
            : .|.|..|.|..|||::||..|.:|.|:...||:||.|.||.....|..:.:..   .||.:||
 Worm   166 V-APNNLALYDITLALEFVKSEIHSFGGNSQKITLFGHSYGGGLASMMTFSSEINRDLSLFQQAI 229

  Fly   220 PMSG 223
            .|||
 Worm   230 VMSG 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est5NP_001246965.1 COesterase 7..510 CDD:278561 68/199 (34%)
cest-5.1NP_501022.3 Abhydrolase 19..495 CDD:389770 68/199 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156912
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.