DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est5 and Nlgn3

DIOPT Version :9

Sequence 1:NP_001246965.1 Gene:alpha-Est5 / 40905 FlyBaseID:FBgn0261393 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_599163.2 Gene:Nlgn3 / 171297 RGDID:621119 Length:848 Species:Rattus norvegicus


Alignment Length:636 Identity:161/636 - (25%)
Similarity:243/636 - (38%) Gaps:174/636 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GQIKGVKRLSLYDD---PYFSFEKIPFAKPPLGELRFRAPVPADPWSGVLDCTHYAEK-PTQRGL 78
            |:::|. |:.|..:   |...:..:|:|.||:||.||..|.|...|||:.:.||:... |.....
  Rat    49 GKLRGA-RVPLPSEILGPVDQYLGVPYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHT 112

  Fly    79 LTREI------------------EGGEDCLYLNVY-----SKQLKSE---KP------------- 104
            ...|:                  |..|||||||||     .|::..|   ||             
  Rat   113 AVPEVMLPVWFTANLDIVATYIQEPNEDCLYLNVYVPTEDVKRISKECARKPNKKICRKGGSGAK 177

  Fly   105 ----------------------LPVMVYIYGGAFTVGE------ATRELYGPDYFMTKDVVLVTL 141
                                  .||||||:||::..|.      :....||       :|:::||
  Rat   178 KQGEDLADNDGDEDEDIRDSGAKPVMVYIHGGSYMEGTGNMIDGSVLASYG-------NVIVITL 235

  Fly   142 NYRVDCLGFLSLKDPSLKVPGNAGLKDQVLALKWVKQYISNFNGDDSNITVFGESAGGCSTHFMM 206
            ||||..|||||..|.:.|  ||.||.||:.||:||.:.|:.|.||...|||||...|......:.
  Rat   236 NYRVGVLGFLSTGDQAAK--GNYGLLDQIQALRWVSENIAFFGGDPRRITVFGSGIGASCVSLLT 298

  Fly   207 CTEQTRGLFHKAIPMSGTVHNYWANN--PAEDFAFRLAQQNGFTGENDDAKVLEYLQGVPARDLV 269
            .:..:.|||.:||..||:..:.||.|  |.: :...||.:.| ....|...:::.|:...|::||
  Rat   299 LSHHSEGLFQRAIIQSGSALSSWAVNYQPVK-YTSLLADKVG-CNVLDTVDMVDCLRQKSAKELV 361

  Fly   270 NHNLLTPEHRRNGLLFAFGPTVEAYVGEDCVVPKPPVEMARDAWSNNFPVMLGGTSFEGLFMYPA 334
            ..::....:.     .||||.::   |:  |:|..|..:.......|:.:|||....|||.....
  Rat   362 EQDIQPARYH-----VAFGPVID---GD--VIPDDPEILMEQGEFLNYDIMLGVNQGEGLKFVEG 416

  Fly   335 VSANLKALDSLSQDPTRLVPVDVRTVSSEKENLEYSQRLMKAYFGYSPPSSELLLNMLDF-YSYK 398
            |......:.....|         .:||:..:||          :|| |...:.|...:.| |:  
  Rat   417 VVDPEDGVSGTDFD---------YSVSNFVDNL----------YGY-PEGKDTLRETIKFMYT-- 459

  Fly   399 IFWHGFNRTFNARLT--------------------YAK--APTYYYRFDFDSPNFNFYRAKFCGD 441
             .|...:.....|.|                    :|:  :|||:|.         ||.  .|..
  Rat   460 -DWADRDNPETRRKTLVALFTDHQWVEPSVVTADLHARYGSPTYFYA---------FYH--HCQS 512

  Fly   442 KIK---TGVAHADDLSYLFRNAGSWKLDKTSAEYRTIERMIG-----IWTAFAATSNPNCP---- 494
            .:|   :..||.|::.|:|........|.....:...:.|:.     .||.||.|.:||.|    
  Rat   513 LMKPAWSDAAHGDEVPYVFGVPMVGPTDLFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNKPVPQD 577

  Fly   495 ---------EIGHLEWKPSTKNDPKRVINISSDVTIIDLPEYEKLQIWDNL 536
                     ....:.|......| :..::|.....:.|.....|:..|.:|
  Rat   578 TKFIHTKANRFEEVAWSKYNPRD-QLYLHIGLKPRVRDHYRATKVAFWKHL 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est5NP_001246965.1 COesterase 7..510 CDD:278561 156/608 (26%)
Nlgn3NP_599163.2 COesterase 40..624 CDD:395084 159/631 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..195 0/25 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 645..691
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336096
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.