DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est5 and ache

DIOPT Version :9

Sequence 1:NP_001246965.1 Gene:alpha-Est5 / 40905 FlyBaseID:FBgn0261393 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_571921.1 Gene:ache / 114549 ZFINID:ZDB-GENE-010906-1 Length:634 Species:Danio rerio


Alignment Length:568 Identity:155/568 - (27%)
Similarity:242/568 - (42%) Gaps:112/568 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VGQIKGVKRLSLYDDPY-FSFEKIPFAKPPLGELRFRAPVPADPWSGVLDCTHYAEKPTQRGLLT 80
            :|:::|. ||.:.|..: .:|..||:|:||:|:.||:...|..||:.|.:...::....|  .:.
Zfish    35 LGRVQGT-RLPVPDRSHVIAFLGIPYAEPPIGKRRFKRAEPKKPWNNVFEAKEFSNACYQ--FVD 96

  Fly    81 REIEG-------------GEDCLYLNVYSKQLKSEKPLPVMVYIYGGAFTVGEATRELYGPDYF- 131
            ....|             .||||||||:.......:.|.|||:||||.|..|.::.::|...|. 
Zfish    97 TSYPGFPGIEMWNPNRVMSEDCLYLNVWVPPTPRPQNLTVMVWIYGGGFYSGSSSLDVYDGRYLA 161

  Fly   132 MTKDVVLVTLNYRVDCLGFLSLKDPSLKVPGNAGLKDQVLALKWVKQYISNFNGDDSNITVFGES 196
            .|:.||:|::||||...|||:|...| ..|||.||.||.|||:||::.|..|.|:...:|:||||
Zfish   162 YTEKVVVVSMNYRVGAFGFLALNGSS-DAPGNVGLYDQRLALQWVQENIHFFGGNPKQVTIFGES 225

  Fly   197 AGGCSTHFMMCTEQTRGLFHKAIPMSGTVHNYWAN---NPAEDFAFRLAQQNGFTGENDDAKVLE 258
            ||..|....:.:..:|.||.:||..||..:..||.   :.|.....:|.:..|.|..| |.::::
Zfish   226 AGAASVGMHVLSPDSRPLFTRAILQSGVPNTPWATVTFDEARRRTTKLGKLVGCTWGN-DTELID 289

  Fly   259 YLQGVPARDLVNH--------NLLTPEHRRNGLLFAFGPTVEAYVGEDCVVPKPPVEMARDAWSN 315
            .|:....::|::.        :|..         |:|.|.|:.     ...|..|..|..   |.
Zfish   290 CLRNKHPQELIDQEWQVLPWSSLFR---------FSFVPVVDG-----VFFPDTPDAMIS---SG 337

  Fly   316 NF---PVMLGGTSFEG----LFMYPAVSANLKALDSLSQDPTRLVPVDV---RTVSSEKENLEYS 370
            ||   .::||....||    |:..|..|.:.::|.| .:|....|.:.|   ..:..|...|:|:
Zfish   338 NFKYTQILLGVNQDEGSYFLLYGAPGFSKDNESLIS-REDFLESVKMGVPHANDIGLEAVILQYT 401

  Fly   371 ----------------------------QRLMKAYFGYS---PPSSELLLNMLDFYSYKIFWHGF 404
                                        |...|:|..|:   ..||......|.       |...
Zfish   402 DWMDENNGQKNRDAMDDIVGDQNVICPLQHFAKSYAQYAALHAQSSAAAPGTLG-------WGNS 459

  Fly   405 NRT-FNARLTYAKAPTYYYRFDFDSPNFNFYRAKFCGDKIKTGVAHADDLSYLFRNAGSWKLDKT 468
            ..| :|:..::  ...|.|.||        :||.........||.|..::.::|......:|:.|
Zfish   460 GPTGYNSGNSH--GAVYLYLFD--------HRASNLAWPEWMGVIHGYEIEFVFGLPLEKRLNYT 514

  Fly   469 SAEYRTIERMIGIWTAFAATSNPNCPEIGHLE----WKPSTKNDPKRV 512
            :.|.:...|::..|..||.|.|||....|.::    |...:.|:.|.|
Zfish   515 AEEEKLSRRIMRYWANFARTGNPNVNTDGTMDSRRRWPQFSANEQKHV 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est5NP_001246965.1 COesterase 7..510 CDD:278561 153/564 (27%)
acheNP_571921.1 COesterase 23..583 CDD:278561 155/568 (27%)
AChE_tetra 598..631 CDD:285837
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575607
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100080
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.