DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTub84D and TUB4

DIOPT Version :9

Sequence 1:NP_524264.1 Gene:alphaTub84D / 40904 FlyBaseID:FBgn0003885 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_013313.1 Gene:TUB4 / 850909 SGDID:S000004202 Length:473 Species:Saccharomyces cerevisiae


Alignment Length:457 Identity:139/457 - (30%)
Similarity:222/457 - (48%) Gaps:36/457 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ECISIHVGQAGVQIGNACWELYCLEHGIQPDG--QMPSDKTVGGGDDSFNTFFSETGAGKHVPRA 65
            |.|::..||.|..:|...|.....||.|..||  |:|...|  ..||....||.|....|..|||
Yeast     4 EIITLQAGQCGNHVGKFLWSQLAKEHAIGTDGLSQLPDSST--ERDDDTKPFFRENSRNKFTPRA 66

  Fly    66 VFVDLEPTVVDEVRTGTYRQLFHPEQLITGKE--DAANNYARGHYTIGKEIVDLVLDRIRKLADQ 128
            :.:|.||:|:.:|. .|:|..|.|.......:  .|.|::|.| |.||....|.:|::|.|..|.
Yeast    67 IMMDSEPSVIADVE-NTFRGFFDPRNTWVASDGASAGNSWANG-YDIGTRNQDDILNKIDKEIDS 129

  Fly   129 CTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTAVVEPYNSILTTHT 193
            ....:||.:.||..||||||..|.|:|.|...|.||....::|:|| :.|..||:.||:||....
Yeast   130 TDNFEGFQLLHSVAGGTGSGLGSNLLEALCDRYPKKILTTYSVFPA-RSSEVVVQSYNTILALRR 193

  Fly   194 TLEHSDCAFMVDNEAIYDICRR-----NLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLT 253
            .:|.||...:.||.::.:|..:     |:|::     :.|:||..|:||:|.|:||...:...::
Yeast   194 LIEDSDATVVFDNASLLNISGKVFRNPNIDLQ-----HTNQLISTIISSVTNSIRFPSYMYSSMS 253

  Fly   254 EFQTNLVPYPRIHFPLVTYAPVIS---AEKAYHEQLSVAEITNACFEPANQMVKVDPRHGKYMAC 315
            ...:.|:|.|.:||...::.|..|   .:...|:..|..::.....:|:|.:|.....:..|...
Yeast   254 SIYSTLIPSPELHFLSPSFTPFTSDYIHDDIAHKGHSSYDVMLDLLDPSNSLVSTAMNNPTYFNV 318

  Fly   316 CMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV--CML 378
            .....|:|.|:.::.|:.  |.::.|:|..|..:...|.|..:.|.:    .|...:..|  .||
Yeast   319 YNTIIGNVEPRQISRAMT--KLQQRIKFPSWSSSAMHVNIGRRSPYL----PLQPNENEVSGMML 377

  Fly   379 SNTTAIAEAWARLDHKFDLMYAKRAFVHWY-VGEGME-----EGEFSEAREDLAALEKDYEEVGM 437
            ||.:.:...:....:.||.::||.||::.| ||:..:     :.||:|:||.:.:|.:||.....
Yeast   378 SNMSTVVNVFENACNTFDKVFAKGAFLNNYNVGDLFQSMQNVQDEFAESREVVQSLMEDYVAAEQ 442

  Fly   438 DS 439
            ||
Yeast   443 DS 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTub84DNP_524264.1 PTZ00335 1..439 CDD:185562 137/455 (30%)
TUB4NP_013313.1 COG5023 2..456 CDD:227356 139/457 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.