DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTub84D and TUBAL3

DIOPT Version :9

Sequence 1:NP_524264.1 Gene:alphaTub84D / 40904 FlyBaseID:FBgn0003885 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_079079.1 Gene:TUBAL3 / 79861 HGNCID:23534 Length:446 Species:Homo sapiens


Alignment Length:443 Identity:327/443 - (73%)
Similarity:390/443 - (88%) Gaps:9/443 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDG--------QMPSDKTVGGGDDSFNTFFSETG 57
            ||||:|||:||||:|||:||||||||||||||:|        |:.:.| :...:.||:|||.||.
Human     1 MRECLSIHIGQAGIQIGDACWELYCLEHGIQPNGVVLDTQQDQLENAK-MEHTNASFDTFFCETR 64

  Fly    58 AGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRI 122
            ||||||||:||||||||:|.:|||.:|.|||||||::||||||||||||.|::|.|::||||:|.
Human    65 AGKHVPRALFVDLEPTVIDGIRTGQHRSLFHPEQLLSGKEDAANNYARGRYSVGSEVIDLVLERT 129

  Fly   123 RKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTAVVEPYNS 187
            ||||:||.||||||||.||||||||||||||||||:.:|.:|:||||:|||||::||||||||||
Human   130 RKLAEQCGGLQGFLIFRSFGGGTGSGFTSLLMERLTGEYSRKTKLEFSVYPAPRISTAVVEPYNS 194

  Fly   188 ILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDL 252
            :||||:|.||:||.|||||||:||||.|.|.:|.|::.::|||:.|:||||||||||:|.|||||
Human   195 VLTTHSTTEHTDCTFMVDNEAVYDICHRKLGVECPSHASINRLVVQVVSSITASLRFEGPLNVDL 259

  Fly   253 TEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKVDPRHGKYMACCM 317
            .|||||||||||||||:..:||::||:||||||.||::||.||||.:||:||.|||.|||||||:
Human   260 IEFQTNLVPYPRIHFPMTAFAPIVSADKAYHEQFSVSDITTACFESSNQLVKCDPRLGKYMACCL 324

  Fly   318 LYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTT 382
            |||||||||:||||||..|::.::|||||||||||||||.:||||:||||||||.|::|||||||
Human   325 LYRGDVVPKEVNAAIAATKSRHSVQFVDWCPTGFKVGINNRPPTVMPGGDLAKVHRSICMLSNTT 389

  Fly   383 AIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEV 435
            ||.|||||||||||||||||||:|||:.|||||.||.||||||||||:|||||
Human   390 AIVEAWARLDHKFDLMYAKRAFLHWYLREGMEEAEFLEAREDLAALERDYEEV 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTub84DNP_524264.1 PTZ00335 1..439 CDD:185562 327/443 (74%)
TUBAL3NP_079079.1 alpha_tubulin 2..442 CDD:276955 324/440 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54134
OrthoDB 1 1.010 - - D275336at33208
OrthoFinder 1 1.000 - - FOG0000082
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100108
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.