DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTub84D and Tubb4b

DIOPT Version :9

Sequence 1:NP_524264.1 Gene:alphaTub84D / 40904 FlyBaseID:FBgn0003885 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_666228.1 Gene:Tubb4b / 227613 MGIID:1915472 Length:445 Species:Mus musculus


Alignment Length:453 Identity:183/453 - (40%)
Similarity:270/453 - (59%) Gaps:18/453 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDD----SFNTFFSETGAGKH 61
            |||.:.:..||.|.|||...||:...||||.|.|      |..|..|    ..|.:::|...||:
Mouse     1 MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTG------TYHGDSDLQLERINVYYNEATGGKY 59

  Fly    62 VPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLA 126
            |||||.|||||..:|.||:|.:.|:|.|:..:.|:..|.||:|:||||.|.|:||.|||.:||.|
Mouse    60 VPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEA 124

  Fly   127 DQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTAVVEPYNSILTT 191
            :.|..||||.:.||.|||||||..:||:.::..:|..:....|:|.|:|:||..||||||:.|:.
Mouse   125 ESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSV 189

  Fly   192 HTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQ 256
            |..:|::|..:.:||||:||||.|.|.:..|||.:||.|:...:|.:|..|||.|.||.||.:..
Mouse   190 HQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA 254

  Fly   257 TNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKVDPRHGKYMACCMLYRG 321
            .|:||:||:||.:..:||:.|.....:..|:|.|:|...|:..|.|...|||||:|:....::||
Mouse   255 VNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRG 319

  Fly   322 DVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAE 386
            .:..|:|:..:..::.|.:..||:|.|...|..:...||        ..::.:...:.|:|||.|
Mouse   320 RMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP--------RGLKMSATFIGNSTAIQE 376

  Fly   387 AWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGMDSGDGEGEGAEE 449
            .:.|:..:|..|:.::||:|||.||||:|.||:||..::..|..:|::....:.:.|||..||
Mouse   377 LFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEFEEE 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTub84DNP_524264.1 PTZ00335 1..439 CDD:185562 178/441 (40%)
Tubb4bNP_666228.1 PLN00220 1..427 CDD:215107 178/439 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 426..445 5/14 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.