DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl2 and RTN1

DIOPT Version :9

Sequence 1:NP_001246964.1 Gene:Rtnl2 / 40903 FlyBaseID:FBgn0015831 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_010519.3 Gene:RTN1 / 851819 SGDID:S000002641 Length:295 Species:Saccharomyces cerevisiae


Alignment Length:233 Identity:54/233 - (23%)
Similarity:92/233 - (39%) Gaps:56/233 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NLLLWRNSRKTLIVFTGILLLLLDVMVHSVISVISMVGITVLIAA----------IGHRLLVQFW 75
            :||||||..:|...|.|.||.||.:...::|:....|..|:|...          :|..|:.:: 
Yeast    22 DLLLWRNPVQTGKYFGGSLLALLILKKVNLITFFLKVAYTILFTTGSIEFVSKLFLGQGLITKY- 85

  Fly    76 SIWKKDENKDQILRFYPHPKIEIPREETLYLAGKAVSHINLILNRM-------IELLLVEKWEDS 133
                             .|| |.|.     :||....||:..|.::       .:.:..:..:.:
Yeast    86 -----------------GPK-ECPN-----IAGFIKPHIDEALKQLPVFQAHIRKTVFAQVPKHT 127

  Fly   134 LKFLVLLCGINLLGDCFNGLTLLIFGHLFIFTVPKLYESYKPFVDVQIRKFRKCKIDKSNVEKPI 198
            .|..|.|..::.....|:..|::....:|.||:|.:|.|||..:|..:.  :..:|.|...::  
Yeast   128 FKTAVALFLLHKFFSWFSIWTIVFVADIFTFTLPVIYHSYKHEIDATVA--QGVEISKQKTQE-- 188

  Fly   199 CIQKECPPESAY-EGQESKEGKVLYEPCDNEPLRNLLE 235
            ..|..|.....| :..|||.|          |:.||::
Yeast   189 FSQMACEKTKPYLDKVESKLG----------PISNLVK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl2NP_001246964.1 Reticulon 21..183 CDD:280592 42/178 (24%)
RTN1NP_010519.3 Reticulon 21..178 CDD:396837 42/181 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I2760
eggNOG 1 0.900 - - E1_KOG1792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I1880
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000492
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.820

Return to query results.
Submit another query.