DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl2 and RTN2

DIOPT Version :9

Sequence 1:NP_001246964.1 Gene:Rtnl2 / 40903 FlyBaseID:FBgn0015831 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_010077.1 Gene:RTN2 / 851323 SGDID:S000002363 Length:393 Species:Saccharomyces cerevisiae


Alignment Length:223 Identity:59/223 - (26%)
Similarity:92/223 - (41%) Gaps:47/223 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LLLWRNSRKTLIVFTGILLLLLDVMVHSVISVISMVGITVLIAAIGHRL--LVQFWSIWKKDENK 84
            |:.|.|..|:...|...|:.||.:...:||||:..:|..||..:....|  .|.|        :|
Yeast    33 LIYWTNPSKSGASFAATLVSLLILRNVNVISVLLKIGYMVLFTSFAVELSTKVLF--------DK 89

  Fly    85 DQILRFYPHPKIEIPREETLYLAGKAVSHINLILNRMIELLLVEKWEDSLKFLV--------LLC 141
            ..:.||        ..:|:..|.|....||:..|:|:..|      ||.::.||        ...
Yeast    90 GVVSRF--------GMQESPDLVGVLKPHIDRELDRLPAL------EDRIRKLVFAHRTRNNFTI 140

  Fly   142 GINL-----LGDCFNGLTLLIFGHLFIFTVPKLYESYKPFVDVQIRKFRKCKIDK--SNVEKPI- 198
            |::|     |...|:..|:||...:|::|||.:|:..:..:|..|.:.:...|.:  .|..|.: 
Yeast   141 GVSLYFLHGLFAIFSMNTVLIMTTIFLYTVPLIYDRKQARIDRAIDRMKDLVIHRFHKNYNKVVE 205

  Fly   199 ----CIQKECPP---ESAYEGQESKEGK 219
                .|.|..||   |.:|....|.|.|
Yeast   206 KTEPYIDKIIPPQTDEGSYSTSISNENK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl2NP_001246964.1 Reticulon 21..183 CDD:280592 47/175 (27%)
RTN2NP_010077.1 Reticulon 33..188 CDD:396837 47/176 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I2760
eggNOG 1 0.900 - - E1_KOG1792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I1880
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000492
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.