DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl2 and RTNLB3

DIOPT Version :9

Sequence 1:NP_001246964.1 Gene:Rtnl2 / 40903 FlyBaseID:FBgn0015831 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001185307.1 Gene:RTNLB3 / 842713 AraportID:AT1G64090 Length:271 Species:Arabidopsis thaliana


Alignment Length:172 Identity:46/172 - (26%)
Similarity:83/172 - (48%) Gaps:37/172 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NLLLWRNSRKTLIVFTGIL------LLLLDVMVHSVISV---ISMVGITVLIAAIGHRLLVQFWS 76
            ::.||||.:    |..|:|      .:|.:::.::::::   ||::.:.||.          .||
plant    82 DIFLWRNKK----VSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLF----------LWS 132

  Fly    77 IWKKDENKDQILRFYPH-PKIEIPREETLYLAGKAVSHINLILNRMIELLL-VEKWEDSLKFLVL 139
            ......:|..:     | |::.||.:..|.||    |.:.:.:||...:|. :....|..|||::
plant   133 SASTFIHKSPL-----HIPEVHIPEDVVLQLA----SGLRIEINRGFTVLRDIASGRDLKKFLLV 188

  Fly   140 LCGINLL---GDCFNGLTLLIFGHLFIFTVPKLYESYKPFVD 178
            :.|:.:|   |...|.|||:....:.:||:|.|||.|:..||
plant   189 IAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVD 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl2NP_001246964.1 Reticulon 21..183 CDD:280592 46/172 (27%)
RTNLB3NP_001185307.1 Reticulon 80..236 CDD:280592 46/172 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 65 1.000 Domainoid score I3611
eggNOG 1 0.900 - - E1_KOG1792
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I2602
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_110713
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.720

Return to query results.
Submit another query.