DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl2 and BTI3

DIOPT Version :9

Sequence 1:NP_001246964.1 Gene:Rtnl2 / 40903 FlyBaseID:FBgn0015831 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_198975.1 Gene:BTI3 / 834162 AraportID:AT5G41600 Length:257 Species:Arabidopsis thaliana


Alignment Length:230 Identity:55/230 - (23%)
Similarity:94/230 - (40%) Gaps:71/230 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NLLLWRNSRKTLIVFTGIL------LLLLDVMVHSVISVISMVGITVLIAAIGHRLLVQFWS--- 76
            ::.||||.:    |..|:|      .:|.::..:.:::.:....|..|.|..       .||   
plant    70 DIFLWRNKK----VSGGVLGAVTASWVLFELFEYHLLAFLCHFAIFALAALF-------LWSNAC 123

  Fly    77 --IWKKDENKDQILRFYPH-PKIEIPREETLYLAGKAVSHINLILNRMIELLL-VEKWEDSLKFL 137
              |.|..          || |::.||.:..|.|    ||.:.:.:||.:.||. :...:|..||:
plant   124 TFIHKST----------PHIPEVHIPEDPILQL----VSGLRIEINRGLTLLRNIASGKDVKKFI 174

  Fly   138 VLLCG---INLLGDCFNGLTLLIFGHLFIFTVPKLYESYKPFVDVQIRKFRKCKIDKSNVEKPIC 199
            :::.|   ::::|.|:|.|||.....:.:||:|.|||.|:..||                     
plant   175 LVIAGLWVLSIIGSCYNFLTLFYTATVLLFTIPVLYEKYEDKVD--------------------- 218

  Fly   200 IQKECPPESAYEGQESKEGKVLYEPCDNEPLRNLL 234
                     ||..:..:|.|..|...|.:.||.::
plant   219 ---------AYGEKAMREIKKQYAVLDEKVLRKVI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl2NP_001246964.1 Reticulon 21..183 CDD:280592 47/177 (27%)
BTI3NP_198975.1 Reticulon 68..224 CDD:396837 49/208 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 65 1.000 Domainoid score I3611
eggNOG 1 0.900 - - E1_KOG1792
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I2602
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2472
orthoMCL 1 0.900 - - OOG6_110713
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.720

Return to query results.
Submit another query.