DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl2 and AT3G10915

DIOPT Version :9

Sequence 1:NP_001246964.1 Gene:Rtnl2 / 40903 FlyBaseID:FBgn0015831 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001326431.1 Gene:AT3G10915 / 820262 AraportID:AT3G10915 Length:251 Species:Arabidopsis thaliana


Alignment Length:173 Identity:37/173 - (21%)
Similarity:74/173 - (42%) Gaps:28/173 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NLLLWRNSRKTL--IVFTGILLLLLDVMVHSVISVISMVGITVLIAAIGHRLLVQFWSIWKKDEN 83
            :|||||....:|  |:.:.:..|:.:......:||.|.|.:.|::.:..|..:..|       .|
plant    68 DLLLWRRRHLSLGVIIISTVAWLIFEFSGLPFLSVSSDVLLIVIMISFVHARVSAF-------RN 125

  Fly    84 KDQILRFYPHPKIEIPREETLYLAGKAVSHINLILNRMI----ELLLVEKWEDSLKFLVLLCGIN 144
            :    :.:..|::.:..|    :...|.:...:.||.::    ::.:...:....|.::.|..::
plant   126 R----QLHSLPELVLSEE----MVNSAAASFRIKLNHLLVMAHDVTVGNDFRLFFKVVICLWLLS 182

  Fly   145 LLGDCFNGLTLLIFGHLFIFTVPKLYESYKPFVDVQIRKFRKC 187
            .:|...:..|||..|.:...|:|.||..|:..||       ||
plant   183 AIGSYISLCTLLYIGTILSVTIPALYSKYQSKVD-------KC 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl2NP_001246964.1 Reticulon 21..183 CDD:280592 35/167 (21%)
AT3G10915NP_001326431.1 Reticulon 67..222 CDD:396837 37/173 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 65 1.000 Domainoid score I3611
eggNOG 1 0.900 - - E1_KOG1792
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I2602
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.820

Return to query results.
Submit another query.