DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl2 and AT2G46170

DIOPT Version :9

Sequence 1:NP_001246964.1 Gene:Rtnl2 / 40903 FlyBaseID:FBgn0015831 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_566065.1 Gene:AT2G46170 / 819224 AraportID:AT2G46170 Length:255 Species:Arabidopsis thaliana


Alignment Length:181 Identity:51/181 - (28%)
Similarity:86/181 - (47%) Gaps:39/181 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NLLLWRN---SRKTLIVFTGILLL-------LLDVMVHSVISVISMVGITVLIAAIGHRLLVQFW 75
            ::.|||:   |...|.|.|.|.:|       ||.::.|  ||::::.|:  .:.:..|.|:    
plant    70 DVFLWRDKKLSGAVLGVATAIWVLFELVEYHLLSLLCH--ISILALGGL--FLWSNAHTLI---- 126

  Fly    76 SIWKKDENKDQILRFYPHPKIEIPREETLYLAGKAVSHIN--LILNRMIELLLVEKWEDSLKFLV 138
                 ::...||      |:|.:|.|..|.:|....:.:|  .::.|.|.|     ..|..|||:
plant   127 -----NKTSPQI------PEIHVPEEAFLVVASSLRNELNQAFVILRSIAL-----GRDLKKFLM 175

  Fly   139 LLCG---INLLGDCFNGLTLLIFGHLFIFTVPKLYESYKPFVDVQIRKFRK 186
            ::.|   |:::|:.||.|||:....:.:.|||.|||.::..||....|..|
plant   176 VVVGLWIISVVGNWFNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMK 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl2NP_001246964.1 Reticulon 21..183 CDD:280592 49/176 (28%)
AT2G46170NP_566065.1 Reticulon 68..224 CDD:396837 49/177 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 65 1.000 Domainoid score I3611
eggNOG 1 0.900 - - E1_KOG1792
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I2602
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3325
orthoMCL 1 0.900 - - OOG6_110713
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.720

Return to query results.
Submit another query.