DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl2 and Rtn4

DIOPT Version :9

Sequence 1:NP_001246964.1 Gene:Rtnl2 / 40903 FlyBaseID:FBgn0015831 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_918943.1 Gene:Rtn4 / 68585 MGIID:1915835 Length:1162 Species:Mus musculus


Alignment Length:161 Identity:55/161 - (34%)
Similarity:88/161 - (54%) Gaps:7/161 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NLLLWRNSRKTLIVFTGILLLLLDVMVHSVISVISMVGITVLIAAIGHRL---LVQFWSIWKKDE 82
            :||.||:.:||.:||...|.|||.:.|.|::||.:.:.:.:|...|..|:   ::|  :|.|.||
Mouse   977 DLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQ--AIQKSDE 1039

  Fly    83 NKDQILRFYPHPKIEIPREETLYLAGKAVSHINLILNRMIELLLVEKWEDSLKFLVLLCGINLLG 147
            ...  .|.|...::.|..|.....:..|:.|:|..:..:..|.||:...|||||.||:.....:|
Mouse  1040 GHP--FRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSLKFAVLMWVFTYVG 1102

  Fly   148 DCFNGLTLLIFGHLFIFTVPKLYESYKPFVD 178
            ..||||||||...:.:|::|.:||.::..:|
Mouse  1103 ALFNGLTLLILALISLFSIPVIYERHQAQID 1133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl2NP_001246964.1 Reticulon 21..183 CDD:280592 55/161 (34%)
Rtn4NP_918943.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..183
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 406..432
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 711..730
Reticulon 975..1139 CDD:280592 55/161 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847503
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000492
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.700

Return to query results.
Submit another query.