DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl2 and rtn1

DIOPT Version :9

Sequence 1:NP_001246964.1 Gene:Rtnl2 / 40903 FlyBaseID:FBgn0015831 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001078819.2 Gene:rtn1 / 677736 XenbaseID:XB-GENE-1011333 Length:764 Species:Xenopus tropicalis


Alignment Length:188 Identity:59/188 - (31%)
Similarity:98/188 - (52%) Gaps:10/188 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LLLWRNSRKTLIVFTGILLLLLDVMVHSVISVISMVGITVLIAAIGHRL---LVQFWSIWKKDEN 83
            ||.||:.::|.|||..:||:|..:...||:|||:.:.:..|.|.|..|:   ::|  ::.|.||.
 Frog   581 LLYWRDIKQTGIVFGSVLLMLFSLTQFSVVSVIAYLALAALSATISFRIYKSVLQ--AVQKTDEG 643

  Fly    84 KDQILRFYPHPKIEIPREETLYLAGKAVSHINLILNRMIELLLVEKWEDSLKFLVLLCGINLLGD 148
            ..  .:.|...:|.:.:|:.........::.|.|:..:..|.||:...|||||.||:..:..:|.
 Frog   644 HP--FKSYLDMEISLSQEQIQKYTDCLQAYTNSIVKELRRLFLVQDLVDSLKFAVLMWLLTYVGA 706

  Fly   149 CFNGLTLLIFGHLFIFTVPKLYESYKPFVDVQ---IRKFRKCKIDKSNVEKPICIQKE 203
            .||||||||...:.:|::|.:|:.|:..:|..   :|......:.|...:.|...|||
 Frog   707 LFNGLTLLIMAVVSMFSLPVVYDKYQAQIDQYLGLVRTNMNTIVTKIQAKIPGTKQKE 764

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl2NP_001246964.1 Reticulon 21..183 CDD:280592 53/166 (32%)
rtn1NP_001078819.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..147
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..400
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 455..475
Reticulon 580..742 CDD:367092 53/164 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000492
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.