DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl2 and rtn4

DIOPT Version :9

Sequence 1:NP_001246964.1 Gene:Rtnl2 / 40903 FlyBaseID:FBgn0015831 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001161159.1 Gene:rtn4 / 677732 XenbaseID:XB-GENE-1012585 Length:1063 Species:Xenopus tropicalis


Alignment Length:177 Identity:56/177 - (31%)
Similarity:92/177 - (51%) Gaps:21/177 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SSQIFMDLKNLLLWRNSRKTLIVFTGILLLLLDVMVHSVISVISMVGITVLIAAIGHRL---LVQ 73
            ||.....:.:|:.||:.:|:..||...|.|||.:.|.|::||::.:.:.:|..:|..|:   ::|
 Frog   869 SSDFIKSVVDLVYWRDIKKSGAVFGASLFLLLSLSVFSIVSVLAYIALALLSVSISFRIYRGVLQ 933

  Fly    74 FWSIWKKDENKDQILRFYPHP-------KIEIPREETLYLAGKAVSHINLILNRMIELLLVEKWE 131
              :|.|.||.         ||       .:.:|.:........|::|:|..:..:..|.|||...
 Frog   934 --AIQKSDEG---------HPFRSILESNLAVPEDLVQKYCNVALNHVNCTVKELRRLFLVEDLV 987

  Fly   132 DSLKFLVLLCGINLLGDCFNGLTLLIFGHLFIFTVPKLYESYKPFVD 178
            |||||.||:.....:|..||||||||...:.:|::|.:||.::..||
 Frog   988 DSLKFAVLMWVFTYIGALFNGLTLLILALISLFSIPVIYERHQTQVD 1034

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl2NP_001246964.1 Reticulon 21..183 CDD:280592 54/168 (32%)
rtn4NP_001161159.1 Reticulon 876..1040 CDD:367092 54/170 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000492
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.