DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl2 and RTN2

DIOPT Version :9

Sequence 1:NP_001246964.1 Gene:Rtnl2 / 40903 FlyBaseID:FBgn0015831 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_005610.1 Gene:RTN2 / 6253 HGNCID:10468 Length:545 Species:Homo sapiens


Alignment Length:158 Identity:46/158 - (29%)
Similarity:86/158 - (54%) Gaps:1/158 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NLLLWRNSRKTLIVFTGILLLLLDVMVHSVISVISMVGITVLIAAIGHRLLVQFWSIWKKDENKD 85
            :||.|:::|.:.:||||:::.||.::..|::||.:.:.:.:|...|..|:..:......:.:..:
Human   347 DLLYWKDTRTSGVVFTGLMVSLLCLLHFSIVSVAAHLALLLLCGTISLRVYRKVLQAVHRGDGAN 411

  Fly    86 QILRFYPHPKIEIPREETLYLAGKAVSHINLILNRMIELLLVEKWEDSLKFLVLLCGINLLGDCF 150
            . .:.|....:.:.||:|..|:.:..|.:.....::....|||...||||..:|...:..:|..|
Human   412 P-FQAYLDVDLTLTREQTERLSHQITSRVVSAATQLRHFFLVEDLVDSLKLALLFYILTFVGAIF 475

  Fly   151 NGLTLLIFGHLFIFTVPKLYESYKPFVD 178
            |||||||.|.:.:||:|.||..::..:|
Human   476 NGLTLLILGVIGLFTIPLLYRQHQAQID 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl2NP_001246964.1 Reticulon 21..183 CDD:280592 46/158 (29%)
RTN2NP_005610.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..183
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 199..250
Reticulon 345..509 CDD:280592 46/158 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157092
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000492
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.700

Return to query results.
Submit another query.