DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl2 and rtn2a

DIOPT Version :9

Sequence 1:NP_001246964.1 Gene:Rtnl2 / 40903 FlyBaseID:FBgn0015831 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_005157528.1 Gene:rtn2a / 569502 ZFINID:ZDB-GENE-060420-1 Length:451 Species:Danio rerio


Alignment Length:165 Identity:44/165 - (26%)
Similarity:81/165 - (49%) Gaps:15/165 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NLLLWRNSRKTLIVFTGILLLLLDVMVHSVISVISMVGITVLIAAIGHRLLVQFWSIWKKDENKD 85
            :|:.|::..:|.:|.||:::.||.:...|:|:|:|.:.:.:|...|..|:..:...:.:..:.  
Zfish   255 DLVYWKDMERTGMVLTGLVVALLSLFQLSIITVVSTLSLAILCFTISVRIYYKLLHVLQLGDG-- 317

  Fly    86 QILRFYPHP-------KIEIPREETLYLAGKAVSHINLILNRMIELLLVEKWEDSLKFLVLLCGI 143
                  .||       .|.:..||..:...:|:......|..:..|:.|.....||||.:|:..:
Zfish   318 ------VHPFQSYLDLDISLSGEEAEHCLQRAIVLSCSALETLRNLIFVGNLFSSLKFWLLMYVV 376

  Fly   144 NLLGDCFNGLTLLIFGHLFIFTVPKLYESYKPFVD 178
            ..||:..|||||:|.|.:.:|:||..|..::..||
Zfish   377 TFLGNLCNGLTLIIIGVIAVFSVPLFYTRHQDKVD 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl2NP_001246964.1 Reticulon 21..183 CDD:280592 44/165 (27%)
rtn2aXP_005157528.1 Reticulon 253..414 CDD:280592 44/165 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592797
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5136
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000492
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.