DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl2 and rtn2b

DIOPT Version :9

Sequence 1:NP_001246964.1 Gene:Rtnl2 / 40903 FlyBaseID:FBgn0015831 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001025130.1 Gene:rtn2b / 562639 ZFINID:ZDB-GENE-060331-95 Length:208 Species:Danio rerio


Alignment Length:186 Identity:47/186 - (25%)
Similarity:98/186 - (52%) Gaps:2/186 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NLLLWRNSRKTLIVFTGILLLLLDVMVHSVISVISMVGITVLIAAIGHRLLVQFWSIWKKDENKD 85
            :|:.|||...|.:||||:::.|..:...|.|:::|.:|::::...:..|||.:..::.:.::...
Zfish     7 DLIYWRNLATTGVVFTGLVVGLASLFQLSAITILSNLGLSIMAFTLPVRLLYKAMTVTRLNDGSH 71

  Fly    86 QILRFYPHPKIEIPREETLYLAGKAVSHINLILNRMIELLLVEKWEDSLKFLVLLCGINLLGDCF 150
            . .:.|......:..|:|:.:|.:.|..|...::.:..|..::...||:||:|.|..:..:|...
Zfish    72 P-FQSYLDEDHTLTDEDTVRMAEQMVLLIATAVSELKRLFFIDSIMDSVKFIVFLYLLTYVGVQA 135

  Fly   151 NGLTLLIFGHLFIFTVPKLYESYKPFVDVQIRKFRKCKIDKSNVEKPICIQKECPP 206
            |||||::.|.:..|::|.||:..:..:| :|.|..:..::|......:.:....||
Zfish   136 NGLTLVMSGVICAFSLPLLYKLQQERID-KIIKAVQLLVEKITEMVDLVVSLAKPP 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl2NP_001246964.1 Reticulon 21..183 CDD:280592 43/161 (27%)
rtn2bNP_001025130.1 Reticulon 5..167 CDD:280592 43/161 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592787
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000492
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.700

Return to query results.
Submit another query.