DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl2 and rtn3

DIOPT Version :9

Sequence 1:NP_001246964.1 Gene:Rtnl2 / 40903 FlyBaseID:FBgn0015831 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_031755957.1 Gene:rtn3 / 549516 XenbaseID:XB-GENE-975126 Length:580 Species:Xenopus tropicalis


Alignment Length:173 Identity:58/173 - (33%)
Similarity:97/173 - (56%) Gaps:23/173 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MDLKNLLLWRNSRKTLIVFTGILLLLLDVMVHSVISVISMVGITVLIAAIGHRL---LVQFWSIW 78
            :.:::||.||:.:::.:||.|.::|||.:...|:|||||.:.:::|...|.:|:   ::|  ::.
 Frog   390 LKVQDLLYWRDVKQSGMVFGGTMVLLLSLAAFSIISVISYLVLSLLAVTISYRVYKSVLQ--AVQ 452

  Fly    79 KKDENKDQILRFYPHPKIEIPREETLYLAGKA--------VSHINLILNRMIELLLVEKWEDSLK 135
            |.||.         || .:...|:.:.|:..|        ::|:|..|..::.|.|||...||||
 Frog   453 KTDEG---------HP-FKPLLEKDIALSSDAFQKALSTSLAHVNHALKYIVRLFLVEDLVDSLK 507

  Fly   136 FLVLLCGINLLGDCFNGLTLLIFGHLFIFTVPKLYESYKPFVD 178
            ..:|:..:..:|..|||:||||.|.|..||.|.:||.||..:|
 Frog   508 LALLMWLMTYVGAVFNGITLLILGVLLAFTAPIVYEKYKVQID 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl2NP_001246964.1 Reticulon 21..183 CDD:280592 58/169 (34%)
rtn3XP_031755957.1 Reticulon 392..556 CDD:396837 58/171 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I4967
OMA 1 1.010 - - QHG50177
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000492
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.