DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl2 and rtn3

DIOPT Version :9

Sequence 1:NP_001246964.1 Gene:Rtnl2 / 40903 FlyBaseID:FBgn0015831 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_021333122.1 Gene:rtn3 / 394047 ZFINID:ZDB-GENE-030710-5 Length:1116 Species:Danio rerio


Alignment Length:203 Identity:58/203 - (28%)
Similarity:100/203 - (49%) Gaps:40/203 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MDLKNLLLWRNSRKTLIVFTGILLLLLDVMVHSVISVISMVGITVLIAAIGHRL---LVQFWSIW 78
            :.:.:|:.||:.:|:.:||...|||||.:...|||||:|.:.:::|...|..|:   ::|  ::.
Zfish   925 LTVNDLVHWRDPKKSGVVFGVSLLLLLSLAAFSVISVVSYLLLSLLCVTISFRIYKSVIQ--AVQ 987

  Fly    79 KKDENKDQILRFYPHP-------KIEIPREETLYLAGKAVSHINLILNRMIELLLVEKWEDSLKF 136
            |.:|.         ||       .:.:|.|.........:||:|..|.:|..|.|||...||||.
Zfish   988 KSNEG---------HPFKALMDKDVTVPPETFRKHVDGCLSHVNRALKQMSRLFLVEDLVDSLKL 1043

  Fly   137 LVLLCGINLLGDCFNGLTLLIFGHLFIFTVPKLYESYKP----FVDVQIRKF------------- 184
            .|::..:..:|..|||:|:||...:.:|:||.:||..|.    ::|:...:|             
Zfish  1044 AVVMWLLTYVGAVFNGITILILADILLFSVPPIYEKNKTQIDHYIDIARTQFNTTVAKLQEKLPG 1108

  Fly   185 --RKCKID 190
              ::||.:
Zfish  1109 AMKRCKAE 1116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl2NP_001246964.1 Reticulon 21..183 CDD:280592 55/175 (31%)
rtn3XP_021333122.1 XPG_I <416..>853 CDD:331126
Reticulon 927..1091 CDD:308200 55/174 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592799
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5136
OMA 1 1.010 - - QHG50177
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000492
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.