DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl2 and Rtnl1

DIOPT Version :9

Sequence 1:NP_001246964.1 Gene:Rtnl2 / 40903 FlyBaseID:FBgn0015831 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001162875.1 Gene:Rtnl1 / 33721 FlyBaseID:FBgn0053113 Length:607 Species:Drosophila melanogaster


Alignment Length:202 Identity:65/202 - (32%)
Similarity:107/202 - (52%) Gaps:9/202 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LKNLLLWRNSRKTLIVFTGILLLLLDVMVHSVISVISMVGITVLIAAIGHRLLVQFWSIWKKDEN 83
            :::|:.||:.:|:.|||...|:.|..:...|||||.:.:.:..|...:..|:........:| .|
  Fly   411 VESLIYWRDVKKSGIVFGAGLITLAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQK-TN 474

  Fly    84 KDQILRFYPHPKIEIPREETLYLAGKAVSHINLILNRMIELLLVEKWEDSLKFLVLLCGINLLGD 148
            :....:.|....:.:..|:...:||.||:|||..::.:..|.|||...||:||.|:|.....:|.
  Fly   475 EGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIIDSIKFGVILWVFTYVGA 539

  Fly   149 CFNGLTLLIFGHLFIFTVPKLYESYKPFVDVQIRKFRKCKI----DKSNVEKPICIQKECPPESA 209
            .|||:||:|...:.:||:||:||:.|..:|..:...|. |:    ||..|..||..:|   ||:|
  Fly   540 WFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLDLVRS-KLTEITDKIRVAIPIGNKK---PEAA 600

  Fly   210 YEGQESK 216
            .|.::.|
  Fly   601 AESEKDK 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl2NP_001246964.1 Reticulon 21..183 CDD:280592 52/161 (32%)
Rtnl1NP_001162875.1 Reticulon 411..575 CDD:280592 52/164 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468824
Domainoid 1 1.000 65 1.000 Domainoid score I3611
eggNOG 1 0.900 - - E1_KOG1792
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000492
OrthoInspector 1 1.000 - - otm3325
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.