DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl2 and Rtn2

DIOPT Version :10

Sequence 1:NP_524263.2 Gene:Rtnl2 / 40903 FlyBaseID:FBgn0015831 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_963856.1 Gene:Rtn2 / 308410 RGDID:1303245 Length:469 Species:Rattus norvegicus


Alignment Length:183 Identity:51/183 - (27%)
Similarity:99/183 - (54%) Gaps:11/183 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TDTLIKAKDSSQIFMD----LKNLLLWRNSRKTLIVFTGILLLLLDVMVHSVISV---ISMVGIT 60
            |...:.:.|.|:..::    :.:||.|:::|.:..:|||::..||.::..|::||   ::::|:.
  Rat   250 TAQCLNSTDQSEFTLEPLLLVADLLYWKDTRTSGAIFTGLMASLLCLLHFSIVSVAAHLALLGLC 314

  Fly    61 VLIAAIGHRLLVQFWSIWKKDENKDQILRFYPHPKIEIPREETLYLAGKAVSHINLILNRMIELL 125
            ..|:...:|.::|  ::.:.|....  .:.|....:.:.||:|..|:.:..||:.....::....
  Rat   315 ATISLRVYRKVLQ--AVHRGDGTNP--FQAYLDMDLTLTREQTERLSQQIASHVVSTATQLRHFF 375

  Fly   126 LVEKWEDSLKFLVLLCGINLLGDCFNGLTLLIFGHLFIFTVPKLYESYKPFVD 178
            |||...||||..:|...:..:|..||||||:|.|.:.:||||.||..::..:|
  Rat   376 LVEDLVDSLKLALLFYILTFVGAIFNGLTLVILGVVALFTVPLLYRQHQAQID 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl2NP_524263.2 Reticulon 21..184 CDD:460562 48/161 (30%)
Rtn2NP_963856.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..180
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..238
Reticulon 270..434 CDD:460562 48/163 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.