DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl2 and PRR18

DIOPT Version :9

Sequence 1:NP_001246964.1 Gene:Rtnl2 / 40903 FlyBaseID:FBgn0015831 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_787118.2 Gene:PRR18 / 285800 HGNCID:28574 Length:295 Species:Homo sapiens


Alignment Length:37 Identity:11/37 - (29%)
Similarity:16/37 - (43%) Gaps:5/37 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 IDKSNVEKPICIQKECPPESAYEGQESKEGKVLYEPC 225
            |.|.::||.:..:...|..|     .|.|.:.|..||
Human   147 IQKRHLEKQLLARPRRPFPS-----PSAEPRRLLAPC 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl2NP_001246964.1 Reticulon 21..183 CDD:280592
PRR18NP_787118.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..133
PRR18 28..295 CDD:292299 11/37 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..227
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157094
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.