powered by:
Protein Alignment Rtnl2 and PRR18
DIOPT Version :9
Sequence 1: | NP_001246964.1 |
Gene: | Rtnl2 / 40903 |
FlyBaseID: | FBgn0015831 |
Length: | 255 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_787118.2 |
Gene: | PRR18 / 285800 |
HGNCID: | 28574 |
Length: | 295 |
Species: | Homo sapiens |
Alignment Length: | 37 |
Identity: | 11/37 - (29%) |
Similarity: | 16/37 - (43%) |
Gaps: | 5/37 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 189 IDKSNVEKPICIQKECPPESAYEGQESKEGKVLYEPC 225
|.|.::||.:..:...|..| .|.|.:.|..||
Human 147 IQKRHLEKQLLARPRRPFPS-----PSAEPRRLLAPC 178
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165157094 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.