DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl2 and Rtn3

DIOPT Version :9

Sequence 1:NP_001246964.1 Gene:Rtnl2 / 40903 FlyBaseID:FBgn0015831 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001003934.1 Gene:Rtn3 / 20168 MGIID:1339970 Length:964 Species:Mus musculus


Alignment Length:190 Identity:66/190 - (34%)
Similarity:99/190 - (52%) Gaps:16/190 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NLLLWRNSRKTLIVFTGILLLLLDVMVHSVISVISMVGITVLIAAIGHRL---LVQFWSIWKKDE 82
            :|:.||:.:||..||...|::||.:...|||||:|.:.:.:|...|..|:   ::|  ::.|.:|
Mouse   778 DLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRVYKSVIQ--AVQKSEE 840

  Fly    83 NKDQILRFYPHPKIEIPREETLYLAGKAVSHINLILNRMIELLLVEKWEDSLKFLVLLCGINLLG 147
            ...  .:.|....|.:..|........|:.|:|..|..:|.|.|||...||||..|.:..:..:|
Mouse   841 GHP--FKAYLDVDITLSSEAFHNYMNAAMVHVNKALKLIIRLFLVEDLVDSLKLAVFMWLMTYVG 903

  Fly   148 DCFNGLTLLIFGHLFIFTVPKLYESYKPFVD--VQIRKFRKCKIDKSNVEKPICIQKECP 205
            ..|||:||||...|.:|:||.:||.||..:|  |.|.:.:    .||.|||   ||.:.|
Mouse   904 AVFNGITLLILAELLVFSVPIVYEKYKTQIDHYVGIARDQ----TKSIVEK---IQAKLP 956

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl2NP_001246964.1 Reticulon 21..183 CDD:280592 58/166 (35%)
Rtn3NP_001003934.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..109
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..200
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 479..536
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 645..674
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 697..723
Reticulon 776..940 CDD:280592 57/165 (35%)
Interaction with FADD. /evidence=ECO:0000250 919..964 18/45 (40%)
Interaction with BACE1. /evidence=ECO:0000250 932..934 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847505
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000492
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.700

Return to query results.
Submit another query.