DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl2 and ret-1

DIOPT Version :9

Sequence 1:NP_001246964.1 Gene:Rtnl2 / 40903 FlyBaseID:FBgn0015831 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001123026.1 Gene:ret-1 / 179981 WormBaseID:WBGene00004336 Length:3303 Species:Caenorhabditis elegans


Alignment Length:184 Identity:56/184 - (30%)
Similarity:97/184 - (52%) Gaps:20/184 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KDSSQIFMDLK-------NLLLWRNSRKTLIVFTGILLLLLDVMVHSVISVISMVGITVLIAAIG 67
            |.....::|.|       :::.||:::|:.||.:..||:|..:..:.:::|::...:..|.||.|
 Worm  3088 KHHGDAWIDFKTVPPCVLDVIYWRDAKKSAIVLSLALLVLFVLAKYPLLTVVTYSLLLALGAAAG 3152

  Fly    68 HRLLVQFWSIWKKDENKDQILRF-YPHPKIEI-------PREETLYLAGKAVSHINLILNRMIEL 124
            .|   ..:|::||.|  .||.:. ..||..||       |:|:....|...|.|...|.|::.:|
 Worm  3153 FR---SIFSVFKKVE--AQIKKTDSEHPFSEILAQDLTLPQEKVHAQADVFVEHATCIANKLKKL 3212

  Fly   125 LLVEKWEDSLKFLVLLCGINLLGDCFNGLTLLIFGHLFIFTVPKLYESYKPFVD 178
            :.||...:|:||.::|..:..:...|:|.||.|.|.|.:|:|||:|||.:..:|
 Worm  3213 VFVESPLESIKFGLVLWSLTYIASWFSGFTLAILGLLGVFSVPKVYESNQEAID 3266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl2NP_001246964.1 Reticulon 21..183 CDD:280592 53/166 (32%)
ret-1NP_001123026.1 PRK01558 <2835..>2918 CDD:304934
Reticulon 3104..3272 CDD:280592 53/168 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165288
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000492
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.