DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl2 and Rtn3

DIOPT Version :9

Sequence 1:NP_001246964.1 Gene:Rtnl2 / 40903 FlyBaseID:FBgn0015831 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_006230711.1 Gene:Rtn3 / 140945 RGDID:620988 Length:959 Species:Rattus norvegicus


Alignment Length:190 Identity:66/190 - (34%)
Similarity:99/190 - (52%) Gaps:16/190 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NLLLWRNSRKTLIVFTGILLLLLDVMVHSVISVISMVGITVLIAAIGHRL---LVQFWSIWKKDE 82
            :|:.||:.:||..||...|::||.:...|||||:|.:.:.:|...|..|:   ::|  ::.|.:|
  Rat   773 DLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRVYKSVIQ--AVQKSEE 835

  Fly    83 NKDQILRFYPHPKIEIPREETLYLAGKAVSHINLILNRMIELLLVEKWEDSLKFLVLLCGINLLG 147
            ...  .:.|....|.:..|........|:.|:|..|..:|.|.|||...||||..|.:..:..:|
  Rat   836 GHP--FKAYLDVDITLSSEAFHSYMNAAMVHVNKALKLIIRLFLVEDLVDSLKLAVFMWLMTYVG 898

  Fly   148 DCFNGLTLLIFGHLFIFTVPKLYESYKPFVD--VQIRKFRKCKIDKSNVEKPICIQKECP 205
            ..|||:||||...|.:|:||.:||.||..:|  |.|.:.:    .||.|||   ||.:.|
  Rat   899 AVFNGITLLILAELLVFSVPIVYEKYKTQIDHYVGIARDQ----TKSIVEK---IQAKLP 951

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl2NP_001246964.1 Reticulon 21..183 CDD:280592 58/166 (35%)
Rtn3XP_006230711.1 Reticulon 771..935 CDD:280592 57/165 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351058
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000492
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.