DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl2 and Rtn1

DIOPT Version :9

Sequence 1:NP_001246964.1 Gene:Rtnl2 / 40903 FlyBaseID:FBgn0015831 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_446317.2 Gene:Rtn1 / 116644 RGDID:620986 Length:779 Species:Rattus norvegicus


Alignment Length:161 Identity:53/161 - (32%)
Similarity:87/161 - (54%) Gaps:7/161 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NLLLWRNSRKTLIVFTGILLLLLDVMVHSVISVISMVGITVLIAAIGHRL---LVQFWSIWKKDE 82
            :||.||:.::|.|||...||||..:...||:||::.:.:..|.|.|..|:   ::|  ::.|.||
  Rat   594 DLLYWRDIKQTGIVFGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVLQ--AVQKTDE 656

  Fly    83 NKDQILRFYPHPKIEIPREETLYLAGKAVSHINLILNRMIELLLVEKWEDSLKFLVLLCGINLLG 147
            ...  .:.|...:|.:.:|:..........::|..|..:..|.||:...|||||.||:..:..:|
  Rat   657 GHP--FKAYLELEITLSQEQIQKYTDCLQLYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVG 719

  Fly   148 DCFNGLTLLIFGHLFIFTVPKLYESYKPFVD 178
            ..|||||||:...:.:||:|.:|..::..||
  Rat   720 ALFNGLTLLLMAVVSMFTLPVVYVKHQAQVD 750

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl2NP_001246964.1 Reticulon 21..183 CDD:280592 53/161 (33%)
Rtn1NP_446317.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 131..184
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..247
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 295..575
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351060
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000492
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.800

Return to query results.
Submit another query.