DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl2 and Rtn1

DIOPT Version :9

Sequence 1:NP_001246964.1 Gene:Rtnl2 / 40903 FlyBaseID:FBgn0015831 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_703187.2 Gene:Rtn1 / 104001 MGIID:1933947 Length:780 Species:Mus musculus


Alignment Length:161 Identity:53/161 - (32%)
Similarity:87/161 - (54%) Gaps:7/161 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NLLLWRNSRKTLIVFTGILLLLLDVMVHSVISVISMVGITVLIAAIGHRL---LVQFWSIWKKDE 82
            :||.||:.::|.|||...||||..:...||:||::.:.:..|.|.|..|:   ::|  ::.|.||
Mouse   595 DLLYWRDIKQTGIVFGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVLQ--AVQKTDE 657

  Fly    83 NKDQILRFYPHPKIEIPREETLYLAGKAVSHINLILNRMIELLLVEKWEDSLKFLVLLCGINLLG 147
            ...  .:.|...:|.:.:|:..........::|..|..:..|.||:...|||||.||:..:..:|
Mouse   658 GHP--FKAYLELEITLSQEQIQKYTDCLQLYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVG 720

  Fly   148 DCFNGLTLLIFGHLFIFTVPKLYESYKPFVD 178
            ..|||||||:...:.:||:|.:|..::..||
Mouse   721 ALFNGLTLLLMAVVSMFTLPVVYVKHQAQVD 751

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl2NP_001246964.1 Reticulon 21..183 CDD:280592 53/161 (33%)
Rtn1NP_703187.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..78
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..176
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..223
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..576
Reticulon 595..757 CDD:280592 53/161 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847507
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000492
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.700

Return to query results.
Submit another query.