DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl2 and RTN3

DIOPT Version :9

Sequence 1:NP_001246964.1 Gene:Rtnl2 / 40903 FlyBaseID:FBgn0015831 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_011543032.1 Gene:RTN3 / 10313 HGNCID:10469 Length:1037 Species:Homo sapiens


Alignment Length:179 Identity:61/179 - (34%)
Similarity:94/179 - (52%) Gaps:9/179 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTDTLIKAKDSSQIFMD--LKNLLLWRNSRKTLIVFTGILLLLLDVMVHSVISVISMVGITVLI 63
            :|...|:|....:::..|  :.:|:.||:.:||..||...|::||.:...|||||:|.:.:.:|.
Human   824 LSKTELVKKHVLARLLTDFSVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLS 888

  Fly    64 AAIGHRL---LVQFWSIWKKDENKDQILRFYPHPKIEIPREETLYLAGKAVSHINLILNRMIELL 125
            ..|..|:   ::|  ::.|.:|...  .:.|....|.:..|........|:.|||..|..:|.|.
Human   889 VTISFRIYKSVIQ--AVQKSEEGHP--FKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLF 949

  Fly   126 LVEKWEDSLKFLVLLCGINLLGDCFNGLTLLIFGHLFIFTVPKLYESYK 174
            |||...||||..|.:..:..:|..|||:||||...|.||:||.:||.||
Human   950 LVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYK 998

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl2NP_001246964.1 Reticulon 21..183 CDD:280592 57/157 (36%)
RTN3XP_011543032.1 Reticulon 844..999 CDD:280592 57/159 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157098
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000492
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.700

Return to query results.
Submit another query.